EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07810 - TMC)
FAM  PF07810
PID  TMC
DES  TMC domain
ANO  14
ALN  116
AID  0.433464
APH  (((((Q7PZP5_ANOGA/338-448:0.56373,(Q6UXY8_HUMAN/724-830:0.28274,(Q7T1T8_FUGRU/369-471:0.33032,(Q7T1T9_FUGRU/475-577:0.19439,(O43284_HUMAN/179-285:0.15809,Q7T1U0_FUGRU/540-646:0.15523):0.04512):0.23189):0.05410):0.33478):0.17698,((Q6NUU5_BRARE/502-612:0.19740,Q7T1T7_FUGRU/456-566:0.14825):0.11010,Q7TN59_MOUSE/484-595:0.23431):0.05618):0.15485,(Q7T1T6_FUGRU/445-555:0.28588,Q7TN62_MOUSE/457-567:0.41768):0.05216):0.17915,Q7TN58_MOUSE/422-532:0.39753):0.63809,YT41_CAEEL/594-709:0.24813,Q9VT17_DROME/1138-1253:0.44334);
ATP  (((((Q7PZP5_ANOGA/338-448,(Q6UXY8_HUMAN/724-830,(Q7T1T8_FUGRU/369-471,(Q7T1T9_FUGRU/475-577,(O43284_HUMAN/179-285,Q7T1U0_FUGRU/540-646))))),((Q6NUU5_BRARE/502-612,Q7T1T7_FUGRU/456-566),Q7TN59_MOUSE/484-595)),(Q7T1T6_FUGRU/445-555,Q7TN62_MOUSE/457-567)),Q7TN58_MOUSE/422-532),YT41_CAEEL/594-709,Q9VT17_DROME/1138-1253);
ATL  6.11909
DNO  14
DLN  348
DID  0.539951
DPH  (((((((Q7T1T6_FUGRU/445-555:0.25877,Q7TN62_MOUSE/457-567:0.33489):0.08709,Q7TN59_MOUSE/484-595:0.20556):0.05737,(Q6NUU5_BRARE/502-612:0.12308,Q7T1T7_FUGRU/456-566:0.19319):0.05304):0.08736,(Q7T1T8_FUGRU/369-471:0.27203,(((Q7T1T9_FUGRU/475-577:0.22505,Q7T1U0_FUGRU/540-646:0.17743):0.08041,O43284_HUMAN/179-285:0.14437):0.14135,Q6UXY8_HUMAN/724-830:0.26527):0.04630):0.19124):0.04734,Q7TN58_MOUSE/422-532:0.29483):0.07517,Q7PZP5_ANOGA/338-448:0.30391):0.36671,YT41_CAEEL/594-709:0.44021,Q9VT17_DROME/1138-1253:0.28056);
DTP  (((((((Q7T1T6_FUGRU/445-555,Q7TN62_MOUSE/457-567),Q7TN59_MOUSE/484-595),(Q6NUU5_BRARE/502-612,Q7T1T7_FUGRU/456-566)),(Q7T1T8_FUGRU/369-471,(((Q7T1T9_FUGRU/475-577,Q7T1U0_FUGRU/540-646),O43284_HUMAN/179-285),Q6UXY8_HUMAN/724-830))),Q7TN58_MOUSE/422-532),Q7PZP5_ANOGA/338-448),YT41_CAEEL/594-709,Q9VT17_DROME/1138-1253);
DTL  4.75253
RID  0.433464
RPH  (((((Q7PZP5_ANOGA/338-448:0.56373,(Q6UXY8_HUMAN/724-830:0.28274,(Q7T1T8_FUGRU/369-471:0.33032,(Q7T1T9_FUGRU/475-577:0.19439,(O43284_HUMAN/179-285:0.15809,Q7T1U0_FUGRU/540-646:0.15523):0.04512):0.23189):0.05410):0.33478):0.17698,((Q6NUU5_BRARE/502-612:0.19740,Q7T1T7_FUGRU/456-566:0.14825):0.11010,Q7TN59_MOUSE/484-595:0.23431):0.05618):0.15485,(Q7T1T6_FUGRU/445-555:0.28588,Q7TN62_MOUSE/457-567:0.41768):0.05216):0.17915,Q7TN58_MOUSE/422-532:0.39753):0.63809,YT41_CAEEL/594-709:0.24813,Q9VT17_DROME/1138-1253:0.44334);
RTP  (((((Q7PZP5_ANOGA/338-448,(Q6UXY8_HUMAN/724-830,(Q7T1T8_FUGRU/369-471,(Q7T1T9_FUGRU/475-577,(O43284_HUMAN/179-285,Q7T1U0_FUGRU/540-646))))),((Q6NUU5_BRARE/502-612,Q7T1T7_FUGRU/456-566),Q7TN59_MOUSE/484-595)),(Q7T1T6_FUGRU/445-555,Q7TN62_MOUSE/457-567)),Q7TN58_MOUSE/422-532),YT41_CAEEL/594-709,Q9VT17_DROME/1138-1253);
RTL  6.11909
LNK  O43284_HUMAN/179-285:O43284:AB002405
LNK  Q6NUU5_BRARE/502-612:Q6NUU5:BC068425
LNK  Q6UXY8_HUMAN/724-830:Q6UXY8:AY358155
LNK  Q7PZP5_ANOGA/338-448:Q7PZP5:AAAB01008986
LNK  Q7T1T6_FUGRU/445-555:Q7T1T6:AY263174
LNK  Q7T1T7_FUGRU/456-566:Q7T1T7:AY263173
LNK  Q7T1T8_FUGRU/369-471:Q7T1T8:AY263172
LNK  Q7T1T9_FUGRU/475-577:Q7T1T9:AY263171
LNK  Q7T1U0_FUGRU/540-646:Q7T1U0:AY263170
LNK  Q7TN58_MOUSE/422-532:Q7TN58:AY236501
LNK  Q7TN59_MOUSE/484-595:Q7TN59:AY236499
LNK  Q7TN62_MOUSE/457-567:Q7TN62:AY236493
LNK  Q9VT17_DROME/1138-1253:Q9VT17:AE003551
LNK  YT41_CAEEL/594-709:Q11069:U23516
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9VT17_DROME/1138-1253
ASQ  CWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDFKIAENILTLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKAS
DSQ  TGCTGGGAGACCTCCTTGGGCCAGGAGCTCTCCAAAGTCATCGTTTTCGATGGGCTGATGTCCATTGTGGCGCCGCTGTGCATCGACTTTCTGCGCGCCCTCTTCGTCCGGTATGTCAATCAAAACTGGTGCTGGGACATGGAGAAGACCTTTCCCCAGTACGGTGACTTCAAGATAGCCGAGAACATCCTGACGTTGATTAATAACCAGGGCCAAGTGTGGATGGGCATATTCTTCTCGCCGGGCCTGGTGCTTATCAACCTGGTCAAATTGATGATCATGATGTACTTCCGTTCGTGGATAGTGCTCACCTGCAATGTGCCGCATGAGGTGGTGTTCAAGGCCTCC
TRN  10010101100011011
NAM  YT41_CAEEL/594-709
ASQ  CWETIIGQEITKLVTMDLYMTVASIFLIDFLRGLACRYLNLYWPWDLERTFPEYGEFKVAENVLHLVNNQGMIWLGLFFVPLLPMLNNIKLIILMYIRGWAAMTCNVPASQIFRAS
DSQ  TGTTGGGAAACAATCATTGGCCAAGAAATAACAAAACTTGTGACAATGGACTTGTACATGACAGTCGCTTCAATTTTTCTGATTGATTTTCTTCGTGGTTTGGCATGTCGATATTTGAATTTATATTGGCCATGGGATTTGGAGAGAACATTTCCTGAGTACGGAGAATTCAAAGTTGCTGAAAATGTGCTTCACTTGGTAAATAATCAAGGAATGATATGGCTCGGGCTCTTCTTTGTTCCACTTCTCCCAATGCTGAATAACATAAAATTGATTATCTTGATGTACATTCGAGGATGGGCTGCAATGACGTGCAATGTTCCGGCCAGTCAAATCTTTCGTGCCAGT
TRN  10010101100011000
NAM  Q7TN62_MOUSE/457-567
ASQ  CWETRLGQEMYKLVLFDLLMGLLVTLLVQFPRKILCGLCPGA-L----GRLSGTLEFQVPDEVLGLIYAQTVVWVGSFFCPLLPLINTAKFLILFCLKKITLFSIYSPASRTFRAS
DSQ  TGCTGGGAGACTCGGCTGGGCCAGGAGATGTACAAACTTGTACTCTTTGATCTGCTGATGGGCCTGTTGGTCACGCTGTTGGTCCAGTTTCCTAGGAAGATACTCTGTGGCCTCTGTCCTGGGGCA---CTG------------GGTCGTCTGTCGGGAACCCTGGAGTTCCAGGTGCCAGATGAGGTGCTGGGGCTCATCTATGCGCAGACCGTGGTCTGGGTGGGAAGCTTCTTCTGCCCTTTACTGCCTTTGATCAACACTGCTAAGTTCCTCATACTGTTCTGCCTGAAGAAGATAACCCTCTTCTCCATATACTCACCGGCTTCCCGCACCTTCCGAGCATCC
TRN  10010101100011000
NAM  Q7T1T6_FUGRU/445-555
ASQ  CWETRVGQEMYKLTVFDLLVTIATLVLVEFPRRMLVDNWSNK-L----VQKLGRQEFVVPANVLVLVYGQTVVWTGALFCPLLPLINTVKFIILFYCKKITLFCNCRPALRTFRST
DSQ  TGCTGGGAAACGCGTGTGGGACAGGAGATGTACAAGCTGACCGTGTTCGACCTGCTCGTCACCATCGCTACGCTGGTGCTGGTGGAGTTCCCACGCAGGATGTTGGTAGACAACTGGTCCAATAAG---CTG------------GTGCAGAAGCTGGGACGGCAGGAGTTTGTCGTTCCCGCCAACGTTCTGGTGCTGGTCTACGGTCAGACTGTGGTTTGGACAGGGGCTCTCTTCTGCCCGCTGCTCCCGCTCATCAACACGGTCAAATTTATCATCCTCTTCTACTGCAAGAAGATCACGCTCTTCTGTAATTGCCGTCCGGCGCTGAGGACCTTTCGATCCACC
TRN  10010101100011011
NAM  Q7TN59_MOUSE/484-595
ASQ  CWETQVGQEMYKLMIFDFIIILAVTLFVDFPRKLLVTYCASSKL----IQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSPLLPAIATLKFVIIFYVKELSLLYTCRPSPRQFRAS
DSQ  TGCTGGGAGACTCAGGTGGGACAGGAAATGTACAAGCTGATGATCTTCGACTTCATCATCATCCTGGCCGTGACGCTGTTTGTGGATTTCCCTAGGAAGCTCCTGGTGACCTACTGTGCCTCCTCAAAGCTG------------ATCCAGTGCTGGGGCCAGCAGGAATTCGCCATCCCCGACAATGTCCTGGGCATCGTGTACGGGCAGACCATCTGTTGGATTGGAGCCTTCTTCTCCCCACTCCTCCCTGCCATTGCCACCTTGAAATTCGTTATCATCTTTTATGTGAAAGAGTTGAGTCTTCTCTACACCTGCAGACCCTCCCCGAGGCAGTTCAGAGCATCC
TRN  10010101100011001
NAM  Q7T1T7_FUGRU/456-566
ASQ  CWETRVGQEMYKLTIFDFIIIAAATISVEFPRKLIVRHCDCG-L----AKWWGQQEFAIPQNVLEIVYGQTICWIGTFYSPMLPAICTIKYFFIFYIKKVSLINNCRPATRPFRAS
DSQ  TGTTGGGAGACCCGCGTGGGCCAGGAGATGTACAAGCTCACCATCTTTGACTTCATCATAATTGCTGCCGCCACCATCTCTGTAGAATTTCCCAGAAAGCTGATCGTGCGGCACTGTGACTGTGGG---CTG------------GCCAAGTGGTGGGGACAGCAGGAGTTCGCCATTCCTCAGAACGTGCTGGAGATTGTCTACGGTCAGACGATTTGCTGGATCGGTACTTTTTACAGTCCGATGCTGCCTGCCATCTGCACCATTAAATACTTTTTTATCTTCTATATAAAGAAGGTTTCACTGATAAACAACTGTCGTCCTGCCACGCGTCCCTTCCGAGCCTCC
TRN  10010101100011001
NAM  Q6NUU5_BRARE/502-612
ASQ  CWETHVGQEMYKLVIFDLLIVAAVTVFVEFPRKMVVQHWRCG-V----TQWLGQQEFSVPQNVLEMVYGQTICWIGAFYCPLLPAINTVKYMLVFYLKKVSLVTNCRPSTRPFRAS
DSQ  TGCTGGGAGACTCACGTTGGTCAGGAGATGTACAAGCTGGTGATCTTTGATCTGCTGATCGTCGCTGCCGTCACCGTCTTCGTGGAGTTCCCCAGGAAGATGGTGGTCCAGCACTGGCGCTGTGGA---GTG------------ACCCAGTGGTTGGGTCAGCAGGAGTTCTCGGTGCCGCAGAATGTTCTGGAGATGGTGTACGGGCAGACCATCTGCTGGATCGGGGCCTTCTACTGCCCCCTGCTGCCCGCCATCAACACCGTCAAATACATGCTGGTGTTTTACCTCAAGAAGGTGTCTCTGGTCACCAACTGTCGTCCCTCCACCCGGCCGTTCCGTGCCTCC
TRN  10010101100011011
NAM  Q7TN58_MOUSE/422-532
ASQ  CWENSVGEELYKLIIFNFLLTVAFAFLVSLPRRLLVERFSGW-F----WTWLDREEFLVPKNVLDIVAAQTVTWMGLFYCPLLPLLNSVFLFLTFYIKKYTLLRNSRASPRRFRAS
DSQ  TGCTGGGAGAACTCGGTGGGCGAAGAATTATATAAGTTAATCATCTTCAACTTCCTGCTCACCGTGGCCTTCGCCTTCCTGGTCAGCCTGCCTCGAAGGCTGTTAGTGGAGCGCTTCTCGGGCTGG---TTC------------TGGACTTGGCTAGACCGGGAGGAGTTCCTGGTGCCTAAGAATGTGCTGGACATCGTGGCTGCACAGACTGTCACCTGGATGGGCCTCTTCTACTGCCCCCTGCTGCCACTACTCAACAGTGTCTTCCTCTTTCTCACCTTCTACATCAAGAAGTACACCCTCCTGAGGAACTCCAGGGCGTCCCCGCGGCGTTTCCGAGCCTCC
TRN  10010101100011010
NAM  Q7PZP5_ANOGA/338-448
ASQ  CWETFVGQQFYKLFIVDFATHFLVTFFVNFPRALFARHSSSR-L----AKFIGEQEFELSKHVLDVIYSQTLCWLGTFYAPFLPAIAALLTFLMFYIKKFACLVNSNPSAILYRAS
DSQ  TGCTGGGAAACATTCGTCGGTCAGCAGTTCTACAAGCTGTTCATCGTCGACTTTGCGACGCACTTTCTCGTGACGTTCTTCGTGAACTTTCCGCGGGCACTGTTTGCGCGCCACTCGAGCTCCCGG---CTG------------GCCAAGTTCATCGGCGAGCAGGAGTTCGAGCTGTCCAAGCACGTGCTGGACGTGATCTACTCGCAGACGCTCTGCTGGCTCGGCACGTTCTACGCGCCCTTCCTGCCGGCGATCGCCGCGCTGCTGACGTTTCTGATGTTTTACATCAAGAAGTTCGCCTGCCTGGTGAACTCGAACCCCTCCGCCATCCTGTACCGGGCGTCC
TRN  11011111101111111
NAM  Q7T1U0_FUGRU/540-646
ASQ  CWESYVGQELYRFLIMEFIFTLLDTLFGELLWRLFSERV---------LRRRRRPVFDIARNVLELIYGQTLAWLGVLFTPLLPAVQILKLLLLFYIKKSSVMMNCQAPRKPYRVS
DSQ  TGCTGGGAGAGCTATGTAGGTCAGGAGCTTTATCGTTTCCTAATTATGGAGTTCATCTTCACTCTACTGGACACCTTGTTTGGGGAGCTTCTTTGGAGGCTGTTCTCTGAAAGAGTG---------------------------CTTAGGAGGAGGAGGAGACCGGTATTTGATATTGCCAGAAATGTCCTTGAACTCATCTATGGACAGACGCTAGCTTGGTTGGGCGTCCTCTTCACTCCTCTTCTGCCTGCAGTTCAGATTCTGAAACTCCTACTACTCTTCTATATTAAGAAGAGCAGCGTGATGATGAACTGCCAGGCCCCGAGGAAACCCTACCGCGTCAGC
TRN  10010101100011011
NAM  O43284_HUMAN/179-285
ASQ  CWEDFVGQELYRFLVMDFVLMLLDTLFGELVWRIISEKK---------LKRRRKPEFDIARNVLELIYGQTLTWLGVLFSPLLPAVQIIKLLLVFYVKKTSLLANCQAPRRPWLAS
DSQ  TGCTGGGAGGATTTTGTGGGCCAGGAGCTGTACCGGTTCCTGGTGATGGACTTCGTCCTCATGTTGCTGGACACGCTTTTTGGGGAACTGGTGTGGAGGATTATCTCCGAGAAGAAG---------------------------CTGAAGAGGAGGCGGAAGCCGGAGTTTGACATTGCCCGGAATGTCCTGGAGCTGATTTATGGGCAGACTCTGACCTGGCTGGGGGTGCTCTTCTCGCCCCTCCTCCCCGCCGTGCAGATCATCAAGCTGCTGCTCGTCTTCTATGTCAAGAAGACCAGCCTTCTGGCCAACTGCCAGGCGCCGCGCCGGCCCTGGCTGGCCTCA
TRN  10010101100011001
NAM  Q7T1T9_FUGRU/475-577
ASQ  CWESFVGQELYRLLLVDFVFTALHTFLGEFLWGQL-------------LKRRRKPGFDIARNVLELIYGQTLTWFGVLFAPLLPAVQIIKLIVLFYLKKSGVLLNCQAPRKPWRAN
DSQ  TGCTGGGAGAGCTTCGTGGGACAAGAACTTTATCGCCTTCTCCTCGTGGACTTTGTCTTCACGGCGCTTCACACATTTTTGGGAGAGTTCCTGTGGGGACAACTG---------------------------------------CTGAAGCGGAGGAGGAAGCCCGGGTTTGATATCGCCCGGAACGTGCTGGAGCTCATATATGGACAAACTCTCACTTGGTTCGGGGTCCTGTTTGCACCACTTCTGCCTGCAGTTCAGATAATAAAGCTGATTGTGCTCTTTTACTTGAAAAAAAGCGGCGTCTTGCTCAACTGCCAGGCTCCGCGAAAGCCCTGGAGGGCCAAT
TRN  10010101100011011
NAM  Q7T1T8_FUGRU/369-471
ASQ  CWESMVGQALYRLVFFDFLFLLLGSFFGEFLSKWL-------------LPSLGVPEFDVARNVFELIYAQTLSWIGIYFSPLLPAIQILKCFILFYVKKVSLAQNCQPPQRTGRAA
DSQ  TGCTGGGAGTCCATGGTGGGACAAGCTCTGTACCGACTGGTCTTTTTTGATTTCCTGTTCCTACTGTTGGGCTCCTTCTTTGGAGAGTTTCTCAGCAAGTGGCTG---------------------------------------CTGCCGAGTTTGGGTGTTCCGGAGTTTGACGTGGCCCGAAATGTCTTCGAGCTCATCTATGCTCAGACGCTGTCCTGGATCGGGATCTACTTCTCTCCACTGCTGCCGGCCATCCAGATTCTCAAATGTTTCATCTTGTTTTATGTAAAGAAGGTCAGCCTGGCTCAGAATTGTCAGCCCCCACAGCGAACAGGGAGGGCAGCT
TRN  10010101100011011
NAM  Q6UXY8_HUMAN/724-830
ASQ  CWETLIGQDIYRLLLMDFVFSLVNSFLGEFLRRIIGMQL---------ITSLGLQEFDIARNVLELIYAQTLVWIGIFFCPLLPFIQMIMLFIMFYSKNISLMMNFQPPSKAWRAS
DSQ  TGTTGGGAAACCCTCATTGGCCAGGACATCTACCGGCTCCTTCTGATGGATTTTGTGTTCTCTTTAGTCAATTCCTTCCTGGGGGAGTTTCTGAGGAGAATCATTGGGATGCAACTG---------------------------ATCACAAGTCTTGGCCTTCAGGAGTTTGACATTGCCAGGAACGTTCTAGAACTGATCTATGCACAAACTCTGGTGTGGATTGGCATCTTCTTCTGCCCCCTGCTGCCCTTTATCCAAATGATTATGCTTTTCATCATGTTCTACTCCAAAAATATCAGCCTGATGATGAATTTCCAGCCTCCGAGCAAAGCCTGGCGGGCCTCA
TRN  10010101100011000
//