EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07764 - Omega_Repress)
FAM  PF07764
PID  Omega_Repress
DES  Omega Transcriptional Repressor
IPR  IPR011686
ANO  2
ALN  71
AID  0.776119
APH  (Q83WL2_9ZZZZ/1-71:0.16681,Q57468_STRPY/1-71:0.11739);
ATP  (Q83WL2_9ZZZZ/1-71,Q57468_STRPY/1-71);
ATL  0.2842
DNO  2
DLN  213
DID  0.835681
DPH  (Q83WL2_9ZZZZ/1-71:0.12199,Q57468_STRPY/1-71:0.06458);
DTP  (Q83WL2_9ZZZZ/1-71,Q57468_STRPY/1-71);
DTL  0.18658
RID  0.776119
RPH  (Q83WL2_9ZZZZ/1-71:0.14839,Q57468_STRPY/1-71:0.13582);
RTP  (Q83WL2_9ZZZZ/1-71,Q57468_STRPY/1-71);
RTL  0.2842
LNK  Q57468_STRPY/1-71:Q57468:X66468
LNK  Q83WL2_9ZZZZ/1-71:Q83WL2:AJ549242
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q83WL2_9ZZZZ/1-71
ASQ  MIVGNLGAQKEKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMEIRLRSKLKSVLIVHY
DSQ  GTGATTGTGGGAAATTTAGGCGCACAAAAAGAAAAACGAAATGATACACCAATCAGTGCAAAAAAAGATATAATGGGAGATAAGACGGTTCGTGTTCGTGCTGACTTGCACCATATCATAAAAATCGAAACAGCAAAGAATGGCGGAAACGTAAAAGAAGTTATGGAAATAAGACTTAGAAGCAAACTTAAGAGTGTGTTGATAGTGCATTAT
TRN  10010101110011010
NAM  Q57468_STRPY/1-71
ASQ  MIVGNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
DSQ  GTGATTGTGGGAAATTTAGGCGCACAAAAAGCAAAACGAAATGATACACCAATCAGTGCAAAAAAAGATATAATGGGAGATAAGACGGTTCGTGTTCGTGCTGACTTGCACCATATCATAAAAATCGAAACAGCAAAGAATGGCGGAAACGTAAAAGAAGTTATGGATCAAGCCTTAGAAGAATATATACGGAAATATTTACCTGACAAACTT
TRN  10010101110011010
//