EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07763 - FEZ)
FAM  PF07763
PID  FEZ
DES  FEZ-like protein
IPR  IPR011680
ANO  5
ALN  273
AID  0.41901
APH  (Q6PBT3_BRARE/60-301:0.26584,FEZ1_RAT/58-301:0.16620,((Q7QD97_ANOGA/14-252:0.37112,O01392_CAEEL/61-327:0.73428):0.47628,Q6P395_MOUSE/33-275:0.34228):0.47719);
ATP  (Q6PBT3_BRARE/60-301,FEZ1_RAT/58-301,((Q7QD97_ANOGA/14-252,O01392_CAEEL/61-327),Q6P395_MOUSE/33-275));
ATL  2.83319
DNO  5
DLN  819
DID  0.512761
DPH  (Q6PBT3_BRARE/60-301:0.24065,FEZ1_RAT/58-301:0.15252,((Q7QD97_ANOGA/14-252:0.25698,O01392_CAEEL/61-327:0.58260):0.23282,Q6P395_MOUSE/33-275:0.32352):0.21946);
DTP  (Q6PBT3_BRARE/60-301,FEZ1_RAT/58-301,((Q7QD97_ANOGA/14-252,O01392_CAEEL/61-327),Q6P395_MOUSE/33-275));
DTL  2.00855
RID  0.41901
RPH  (Q6PBT3_BRARE/60-301:0.26584,FEZ1_RAT/58-301:0.16620,((Q7QD97_ANOGA/14-252:0.37112,O01392_CAEEL/61-327:0.73428):0.47628,Q6P395_MOUSE/33-275:0.34228):0.47719);
RTP  (Q6PBT3_BRARE/60-301,FEZ1_RAT/58-301,((Q7QD97_ANOGA/14-252,O01392_CAEEL/61-327),Q6P395_MOUSE/33-275));
RTL  2.83319
LNK  FEZ1_RAT/58-301:P97577:U48249
LNK  O01392_CAEEL/61-327:O01392:U60059
LNK  Q6P395_MOUSE/33-275:Q6P395:BC064130
LNK  Q6PBT3_BRARE/60-301:Q6PBT3:BC059593
LNK  Q7QD97_ANOGA/14-252:Q7QD97:AAAB01008859
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q6PBT3_BRARE/60-301
ASQ  SMEDLVNEFDEKLNVCFHNYNTKTEGLAPVRNQSHAEEDEERLQDEDVWDALTDNYMPSSVSSWDDPTSETLNGNLSDQEIH-------------EKDED-EMNEKNENANCL----------NEEPLITADQVIEEIVEMMENSPDPGETEEE-EEDDIGVSSSKSSPSLLEEIR------MLSQASNNNCSYEGLRLMPSSALLDILCRMEAAIREYSEELVAQLARRDELEFEKEVKNTFITALMEVQNRQKEQRELSKRRRKDKAMSLQ
DSQ  TCCATGGAGGATCTGGTCAATGAATTTGACGAGAAGCTGAACGTGTGCTTCCACAATTACAACACCAAGACAGAAGGTCTGGCACCCGTGCGCAACCAATCACATGCTGAGGAGGATGAGGAGAGGCTTCAGGATGAAGATGTGTGGGATGCTCTGACTGACAACTACATGCCCTCCTCTGTGTCCAGCTGGGACGACCCCACCTCGGAAACACTCAACGGCAACCTCTCGGATCAGGAGATACAC---------------------------------------GAAAAAGATGAGGAT---GAGATGAACGAGAAGAATGAAAATGCCAACTGTCTG------------------------------AATGAAGAACCTCTTATTACAGCTGATCAGGTGATTGAGGAGATTGTGGAGATGATGGAAAACTCACCGGATCCTGGAGAGACAGAGGAAGAG---GAGGAGGATGATATCGGGGTCTCTTCCTCTAAAAGCAGCCCGTCTCTTCTGGAGGAGATCCGC------------------ATGCTGTCTCAGGCCTCCAATAACAACTGCTCCTACGAAGGTCTGAGGCTGATGCCGAGCTCTGCACTGCTTGACATCTTGTGCCGGATGGAGGCGGCGATTCGAGAGTATTCAGAGGAACTGGTGGCTCAGCTGGCCCGGAGAGATGAGCTGGAGTTCGAGAAGGAGGTGAAGAACACCTTCATCACAGCTCTGATGGAGGTGCAGAACAGACAGAAGGAGCAGAGGGAGCTGAGTAAGCGCAGGCGTAAAGACAAGGCCATGAGTCTACAG
TRN  10010101100011001
NAM  FEZ1_RAT/58-301
ASQ  SMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLRDEEVWDALTDNYIPSLSEDWRDPNIEALNGNSSDTEIH-------------EKEEEDEFIEKSENDSGI----------NEEPLLTADQVIEEIEEMMQNSPDPEEEVEVLEEEDGGEISSQADSVLLQEMQ------ALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVHQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQ
DSQ  TCCATGGAGGACCTCGTGAATGAATTTGATGAGAAGCTCAATGTCTGCTTTCGGAACTACAATGCCAAGACCGAGAACCTGGCTCCAGTGAAGAACCAGTTGCAGATCCAGGAGGAGGAGGAGACTCTTCGGGATGAGGAGGTTTGGGATGCTCTGACAGACAATTACATCCCTTCACTCTCAGAAGACTGGAGGGACCCAAACATTGAAGCTCTGAATGGCAACAGCTCTGACACTGAGATCCAC---------------------------------------GAGAAGGAAGAAGAAGATGAGTTCATTGAGAAGAGTGAAAACGACTCTGGTATC------------------------------AACGAGGAGCCTCTGCTCACAGCTGACCAGGTGATTGAGGAGATCGAAGAAATGATGCAGAACTCCCCAGATCCTGAGGAGGAAGTGGAGGTGCTTGAAGAGGAGGATGGAGGAGAAATCTCGTCTCAGGCAGATTCAGTCCTGCTACAAGAGATGCAG------------------GCCCTGACGCAGACCTTCAACAACAACTGGTCCTATGAAGGGCTGAGACACATGTCTGGGTCTGAGCTGACAGAGCTGCTGGACCAGGTGGAGGGTGCCATCCGTGACTTCTCGGAGGAGCTGGTCCACCAGCTGGCCCGCAGAGATGAGCTGGAGTTTGAGAAGGAAGTGAAGAACTCTTTCATCACGGTGCTCATTGAGGTTCAGAATAAGCAGAAGGAGCAGCGGGAACTGATGAAGAAGAGGCGGAAAGAGAAGGGGTTAAGCCTGCAG
TRN  10010101100011000
NAM  Q6P395_MOUSE/33-275
ASQ  SFPALASSLEEKLSLCFRPT-SEAE---PPRAAVRPITECSLLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLTLNLSEK----GMNDGLLFDASDEE-ELREQLDMHSII------VSCVNEEPLFTADQVIEEIEEMMQESPDPEDDETP--------TQSDRLSMLSQEIQ------TLKRS-SMSSYEERVKRLSVSELNELLEEIEAAIKQYSEELVQQLALRDELEFEKEVENSFISALIEVQNKQKEHKETAKKKKKLKSGSSQ
DSQ  AGCTTCCCGGCGCTGGCTTCCAGCCTGGAGGAGAAGCTGAGCCTGTGCTTCCGCCCCACG---TCGGAGGCCGAG---------CCCCCACGGGCGGCCGTGCGGCCCATCACGGAGTGCAGCCTCCTGCAAGGGGACGAGATTTGGAATGCCCTGACAGATAACTATGGGAATGTCATGCCTGTAGACTGGAAGTCGTCCCATACAAGGACCTTGCATTTGCTTACTCTGAACCTCTCGGAGAAA------------GGGATGAACGACGGCTTGCTCTTTGACGCCTCGGATGAGGAG---GAGCTGAGGGAGCAGTTGGACATGCATTCGATCATT------------------GTCTCCTGTGTCAACGAAGAGCCTCTCTTCACTGCAGACCAGGTGATTGAAGAAATTGAAGAAATGATGCAGGAGTCACCAGACCCAGAAGACGACGAGACCCCC------------------------ACACAGTCAGACCGGCTCTCTATGCTCTCCCAGGAGATTCAG------------------ACTCTCAAGAGGTCT---AGCATGAGCAGCTATGAAGAGCGAGTGAAAAGGCTGTCGGTGTCTGAGCTAAACGAACTGCTGGAAGAGATCGAGGCAGCCATTAAGCAGTACTCTGAGGAGCTGGTGCAGCAGCTGGCCCTGCGAGATGAACTCGAGTTCGAGAAGGAAGTGGAAAACAGCTTCATTTCCGCTCTGATTGAGGTGCAGAACAAGCAGAAAGAACACAAAGAGACAGCCAAGAAGAAGAAGAAGCTCAAAAGTGGCAGCTCTCAG
TRN  10010101100011001
NAM  O01392_CAEEL/61-327
ASQ  SLEDLVGNFDEKIAACLKDHEVTTADIAPVQIRTQ----EEVMNESQTWWTLTGNFGNIQPLDFGTSSICKKMAAALDSDSLKDDASTRRSMTN-SDDED-LLRQQMDVHQMIGHHHGSTDTGGETPPQTADQVIEEIDEMLQSCDFTGSMMTDRTMESVDSMYSSMRSPFPSSIQSSDADIKLRSAQALVSNPDNLQELSYSKLVTLCAEMEQLIRVYNESLVDELAHRDELDYEKEMKNSFISLLLAIQNKRRVYANDRKRKVGKASDASQ
DSQ  TCCCTTGAGGACCTTGTCGGCAACTTTGACGAAAAAATTGCGGCATGCCTGAAGGACCACGAGGTGACGACAGCGGATATTGCACCTGTGCAGATACGTACTCAA------------GAGGAAGTTATGAATGAAAGCCAAACATGGTGGACATTAACCGGAAACTTTGGAAACATTCAACCTCTCGACTTTGGAACCTCTTCGATATGTAAAAAGATGGCCGCAGCTCTGGACAGTGATTCATTGAAAGACGACGCATCTACACGCCGAAGTATGACAAAT---TCCGATGATGAGGAT---CTTTTACGACAACAAATGGATGTTCATCAAATGATTGGACATCATCATGGATCTACGGATACTGGTGGTGAAACACCTCCACAGACTGCTGATCAAGTTATCGAAGAAATTGATGAAATGTTACAGTCATGCGATTTCACTGGCTCAATGATGACGGATCGAACGATGGAATCAGTTGATTCAATGTATTCTTCAATGCGTTCACCATTTCCATCATCAATTCAATCATCAGATGCTGATATTAAACTTCGAAGTGCACAGGCCCTTGTCAGCAATCCGGATAATCTTCAAGAGCTCTCCTATTCGAAATTGGTGACACTATGCGCGGAAATGGAGCAGCTGATTCGGGTTTATAATGAGAGTTTGGTCGATGAGCTGGCACATCGAGATGAGCTGGACTACGAAAAAGAGATGAAAAACTCGTTTATTTCACTATTACTGGCGATTCAAAACAAGCGACGAGTTTACGCTAATGATCGGAAACGGAAGGTCGGAAAGGCGTCGGATGCTTCACAA
TRN  10010101100011000
NAM  Q7QD97_ANOGA/14-252
ASQ  SLEDLVNTFDEKITKCFGNYEQSVEELAPVQVRSQ----EEIMNECQMWWTITGNFGNILPIDWSKTYARQMHVPALNLGMR-KPGTPDDELLQDLSSEDEAVASDLDMHALI---LGGLHADNE-PIKTADEVIKEIDDIMDE---TGSEDGQLENEVIEKAKEVLGSPL---------------------YEEKLRSLSITQLNELYMEMEVLIREFSETLISELALRDELEYEKELKNTFISLLLAVQNRRRQYH-VEKKKGKAGGKGSA
DSQ  AGTCTGGAGGATTTGGTCAACACGTTCGACGAGAAGATCACGAAATGCTTCGGCAACTACGAGCAGTCGGTGGAGGAGCTGGCCCCGGTGCAGGTCCGCTCGCAG------------GAGGAAATCATGAACGAGTGCCAGATGTGGTGGACTATTACGGGCAACTTTGGCAACATTCTACCGATCGATTGGTCGAAAACGTACGCGCGCCAGATGCACGTCCCGGCGCTGAACCTTGGCATGCGC---AAGCCCGGCACACCGGACGATGAGCTGCTGCAGGATCTCAGCTCGGAGGACGAAGCGGTCGCCAGCGATCTCGACATGCATGCGCTCATA---------CTCGGCGGCCTGCACGCGGACAACGAA---CCGATCAAGACGGCGGACGAGGTGATCAAGGAGATCGATGACATCATGGACGAG---------ACCGGCTCGGAGGACGGGCAGCTCGAGAATGAAGTAATTGAGAAGGCCAAGGAAGTGCTCGGCTCACCGCTG---------------------------------------------------------------TACGAAGAAAAATTGCGCTCCCTGTCGATCACGCAGCTAAATGAGCTGTACATGGAGATGGAGGTGCTGATTCGCGAGTTCTCCGAGACGCTCATCTCGGAGCTGGCACTGCGCGACGAGCTGGAGTACGAGAAGGAGCTCAAGAACACGTTCATCTCGCTGCTGCTGGCCGTCCAGAATCGTCGCCGCCAGTACCAC---GTGGAAAAGAAGAAGGGAAAGGCAGGGGGCAAAGGATCGGCC
TRN  10010101100011001
//