EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07707 - BACK)
FAM  PF07707
PID  BACK
DES  BTB And C-terminal Kelch
IPR  IPR011705
ANO  88
ALN  108
AID  0.278751
APH  (((((((((((((Q6INL2_XENLA/135-237:0.32756,Q6ZUS1_HUMAN/117-219:0.50365):0.49392,(Q9W6R2_FUGRU/75-177:0.33490,Q9W6R3_FUGRU/76-178:0.52844):0.49266):0.05075,(((Q6GQU2_MOUSE/139-240:0.83273,Q8CA72_MOUSE/133-235:0.66559):0.13155,((Q7QAK9_ANOGA/104-206:0.12040,Q7KSF5_DROME/192-294:0.11265):0.26418,(KEAP1_RAT/184-286:0.15224,Q8JIM0_BRARE/160-262:0.37640):0.37580):0.18568):0.12156,(Q8NFY9_HUMAN/126-229:0.75677,Q9D618_MOUSE/131-233:0.61072):0.20318):0.08872):0.03122,(Q6IR89_XENLA/133-234:0.57154,Q6N066_HUMAN/154-256:0.82656):0.30402):0.07268,((((Q6GKZ1_DROME/195-298:0.77159,KBTB9_MOUSE/216-318:0.49703):0.13553,Q8BSF5_MOUSE/136-237:0.74974):0.25065,((KBTBA_HUMAN/135-237:0.13698,Q6P4N4_XENTR/135-237:0.11949):0.10158,Q7SYD2_BRARE/136-238:0.21663):0.66232):0.04972,((Q6PF15_HUMAN/9-111:0.63743,(Q6NRT8_XENLA/167-269:0.17017,Q7SYC4_BRARE/168-270:0.19513):0.19792):0.06445,(KLHL6_MOUSE/163-265:0.34296,Q8AW66_BRARE/167-269:0.17498):0.40428):0.16726):0.07074):0.07719,(((ENC1_HUMAN/149-251:0.32728,(Q6GNW3_XENLA/149-250:0.29742,Q6TEQ2_BRARE/149-251:0.20960):0.16899):0.09113,(Q6DFF7_XENLA/149-251:0.11034,Q8R2P1_MOUSE/149-251:0.30140):0.11381):0.56016,((IPP_MOUSE/139-241:0.20291,Q6GNZ5_XENLA/139-241:0.20500):0.48159,(Q7PMB5_ANOGA/142-244:0.15249,Q9VK21_DROME/187-289:0.27378):0.44296):0.20534):0.14757):0.05028,((((Q18670_CAEEL/173-275:0.73831,((KELC_DROME/258-360:0.30616,KELC_ANOST/201-303:0.13432):0.21459,(KLHL2_HUMAN/158-260:0.12033,Q8N4I8_HUMAN/152-254:0.15074):0.11959):0.14303):0.16431,(Q7Q1T2_ANOGA/174-276:0.42668,KLH17_MOUSE/192-294:0.28430):0.06781):0.10042,((Q7PXP7_ANOGA/216-318:0.18492,Q86BQ6_DROME/179-281:0.18991):0.31432,((Q6PGA3_MOUSE/223-324:0.19255,Q8CCY1_MOUSE/317-418:0.21419):0.05011,Q6PFE1_MOUSE/275-376:0.14871):0.23215):0.24098):0.08447,(Q6NRH0_XENLA/125-227:0.58040,(O61795_CAEEL/158-260:0.47797,Q6DFF6_XENLA/165-267:0.21781):0.09442):0.05170):0.11474):0.06837,(BTBD5_MOUSE/137-239:0.66824,((KLH18_HUMAN/75-177:0.01715,Q6IQ87_BRARE/140-242:0.22224):0.28006,(((O18147_CAEEL/153-255:0.67082,KLHL8_MOUSE/178-280:0.74805):0.08823,Q6DJ21_XENTR/98-200:0.63143):0.15470,(Q7QHD7_ANOGA/142-244:0.29247,Q9VGE5_DROME/143-245:0.25933):0.13870):0.06564):0.13582):0.05928):0.16506,(Q5SY28_HUMAN/138-239:0.40123,Q6NYM1_BRARE/140-242:0.17322):0.68398):0.09011,((((Q6AX46_XENLA/177-277:0.00000,Q9DB72_MOUSE/169-269:0.53860):1.04450,((Q6GML3_BRARE/142-241:0.26581,Q8C2V5_MOUSE/142-240:0.28630):0.11273,(O16313_CAEEL/170-270:0.82859,(Q9W2S3_DROME/150-248:0.30005,(Q7QI84_ANOGA/148-248:0.19640,Q7QIC9_ANOGA/141-242:0.54780):0.23603):0.11113):0.17282):0.52235):0.44267,(P87597_COWPX/101-204:0.80724,Q7ZVF7_BRARE/174-276:0.72424):0.12071):0.07097,((Q9W4L5_DROME/162-265:0.80601,((Q8IH95_DROME/224-325:0.53783,Q9V755_DROME/214-317:0.45496):0.32402,Q9W4S3_DROME/306-407:0.54986):0.08803):0.59015,((Q8JU17_LSDV/121-220:0.75757,Q8IQ29_DROME/76-176:1.31679):0.43549,((O72746_COWPX/102-200:0.77553,(Q8JTM8_LSDV/120-221:0.71546,Q8JTN6_LSDV/122-221:0.48267):0.21769):0.10176,(O72736_COWPX/123-222:0.52448,((Q8V3G0_SWPV/125-224:0.61543,Q9Q8G2_9POXV/125-224:0.44772):0.20379,Q9DHH3_YLDV/126-228:0.44900):0.31737):0.45883):0.20821):0.15239):0.21996):0.23947):0.18572,(Q6Q7X9_BRARE/173-274:0.10073,Q8BWA5_MOUSE/172-273:0.17528):0.44838):0.31384,(Q6DE07_XENLA/176-277:0.46678,Q8BGY4_MOUSE/156-257:0.52023):0.08762):0.87503,Q6KAS2_MOUSE/175-277:0.22019,Q8N4N3_HUMAN/148-250:0.02875);
ATP  (((((((((((((Q6INL2_XENLA/135-237,Q6ZUS1_HUMAN/117-219),(Q9W6R2_FUGRU/75-177,Q9W6R3_FUGRU/76-178)),(((Q6GQU2_MOUSE/139-240,Q8CA72_MOUSE/133-235),((Q7QAK9_ANOGA/104-206,Q7KSF5_DROME/192-294),(KEAP1_RAT/184-286,Q8JIM0_BRARE/160-262))),(Q8NFY9_HUMAN/126-229,Q9D618_MOUSE/131-233))),(Q6IR89_XENLA/133-234,Q6N066_HUMAN/154-256)),((((Q6GKZ1_DROME/195-298,KBTB9_MOUSE/216-318),Q8BSF5_MOUSE/136-237),((KBTBA_HUMAN/135-237,Q6P4N4_XENTR/135-237),Q7SYD2_BRARE/136-238)),((Q6PF15_HUMAN/9-111,(Q6NRT8_XENLA/167-269,Q7SYC4_BRARE/168-270)),(KLHL6_MOUSE/163-265,Q8AW66_BRARE/167-269)))),(((ENC1_HUMAN/149-251,(Q6GNW3_XENLA/149-250,Q6TEQ2_BRARE/149-251)),(Q6DFF7_XENLA/149-251,Q8R2P1_MOUSE/149-251)),((IPP_MOUSE/139-241,Q6GNZ5_XENLA/139-241),(Q7PMB5_ANOGA/142-244,Q9VK21_DROME/187-289)))),((((Q18670_CAEEL/173-275,((KELC_DROME/258-360,KELC_ANOST/201-303),(KLHL2_HUMAN/158-260,Q8N4I8_HUMAN/152-254))),(Q7Q1T2_ANOGA/174-276,KLH17_MOUSE/192-294)),((Q7PXP7_ANOGA/216-318,Q86BQ6_DROME/179-281),((Q6PGA3_MOUSE/223-324,Q8CCY1_MOUSE/317-418),Q6PFE1_MOUSE/275-376))),(Q6NRH0_XENLA/125-227,(O61795_CAEEL/158-260,Q6DFF6_XENLA/165-267)))),(BTBD5_MOUSE/137-239,((KLH18_HUMAN/75-177,Q6IQ87_BRARE/140-242),(((O18147_CAEEL/153-255,KLHL8_MOUSE/178-280),Q6DJ21_XENTR/98-200),(Q7QHD7_ANOGA/142-244,Q9VGE5_DROME/143-245))))),(Q5SY28_HUMAN/138-239,Q6NYM1_BRARE/140-242)),((((Q6AX46_XENLA/177-277,Q9DB72_MOUSE/169-269),((Q6GML3_BRARE/142-241,Q8C2V5_MOUSE/142-240),(O16313_CAEEL/170-270,(Q9W2S3_DROME/150-248,(Q7QI84_ANOGA/148-248,Q7QIC9_ANOGA/141-242))))),(P87597_COWPX/101-204,Q7ZVF7_BRARE/174-276)),((Q9W4L5_DROME/162-265,((Q8IH95_DROME/224-325,Q9V755_DROME/214-317),Q9W4S3_DROME/306-407)),((Q8JU17_LSDV/121-220,Q8IQ29_DROME/76-176),((O72746_COWPX/102-200,(Q8JTM8_LSDV/120-221,Q8JTN6_LSDV/122-221)),(O72736_COWPX/123-222,((Q8V3G0_SWPV/125-224,Q9Q8G2_9POXV/125-224),Q9DHH3_YLDV/126-228))))))),(Q6Q7X9_BRARE/173-274,Q8BWA5_MOUSE/172-273)),(Q6DE07_XENLA/176-277,Q8BGY4_MOUSE/156-257)),Q6KAS2_MOUSE/175-277,Q8N4N3_HUMAN/148-250);
ATL  55.4478
DNO  86
DLN  324
DID  0.415097
DPH  (((Q6PF15_HUMAN/9-111:0.34744,(KLHL6_MOUSE/163-265:0.37369,Q8AW66_BRARE/167-269:0.19579):0.17963):0.05893,(Q6NRT8_XENLA/167-269:0.29161,Q7SYC4_BRARE/168-270:0.15601):0.15656):0.14124,((((Q6INL2_XENLA/135-237:0.41482,Q6ZUS1_HUMAN/117-219:0.24073):0.20120,(Q5SY28_HUMAN/138-239:0.22835,Q6NYM1_BRARE/140-242:0.30236):0.16338):0.07031,Q8BSF5_MOUSE/136-237:0.55911):0.09448,((ENC1_HUMAN/149-251:0.28288,(Q6GNW3_XENLA/149-250:0.30804,Q6TEQ2_BRARE/149-251:0.20902):0.12812):0.06720,(Q6DFF7_XENLA/149-251:0.22509,Q8R2P1_MOUSE/149-251:0.21294):0.04171):0.31438):0.01128,(((((Q8IQ29_DROME/76-176:0.65397,Q9D618_MOUSE/131-233:0.52940):0.19930,((((((((((Q8JU17_LSDV/121-220:0.47479,Q8JTM8_LSDV/120-221:0.34421):0.12140,Q8JTN6_LSDV/122-221:0.40407):0.01942,O72746_COWPX/102-200:0.53808):0.07639,(O72736_COWPX/123-222:0.44352,((Q9DHH3_YLDV/126-228:0.33538,Q8V3G0_SWPV/125-224:0.44602):0.00000,Q9Q8G2_9POXV/125-224:0.57132):0.10212):0.19553):0.11452,P87597_COWPX/101-204:0.53664):0.05384,Q6N066_HUMAN/154-256:0.64417):0.15572,Q8NFY9_HUMAN/126-229:0.39599):0.18843,(Q6GQU2_MOUSE/139-240:0.43880,Q6IR89_XENLA/133-234:0.49650):0.14663):0.00473,BTBD5_MOUSE/137-239:0.40498):0.11517,((KBTBA_HUMAN/135-237:0.13403,Q6P4N4_XENTR/135-237:0.19593):0.10548,Q7SYD2_BRARE/136-238:0.24827):0.28815):0.08830):0.04837,(Q6GKZ1_DROME/195-298:0.52376,(Q9W6R2_FUGRU/75-177:0.19515,Q9W6R3_FUGRU/76-178:0.37577):0.20129):0.21122):0.08893,((((((Q6AX46_XENLA/177-277:0.38286,Q9DB72_MOUSE/169-269:0.14628):0.60205,(Q7QAK9_ANOGA/104-206:0.16969,Q7KSF5_DROME/192-294:0.18491):0.15034):0.00829,(KEAP1_RAT/184-286:0.13297,Q8JIM0_BRARE/160-262:0.31658):0.23142):0.08412,Q8CA72_MOUSE/133-235:0.47848):0.08387,((IPP_MOUSE/139-241:0.20418,Q6GNZ5_XENLA/139-241:0.21721):0.39397,(Q7PMB5_ANOGA/142-244:0.21663,Q9VK21_DROME/187-289:0.24715):0.25583):0.09705):0.04137,((((Q9W4L5_DROME/162-265:0.53792,(Q8IH95_DROME/224-325:0.40147,Q9V755_DROME/214-317:0.37454):0.17493):0.00000,Q9W4S3_DROME/306-407:0.45066):0.30779,(O16313_CAEEL/170-270:0.71383,((Q6GML3_BRARE/142-241:0.30281,Q8C2V5_MOUSE/142-240:0.33573):0.08515,((Q7QIC9_ANOGA/141-242:0.35339,Q7QI84_ANOGA/148-248:0.20886):0.16343,Q9W2S3_DROME/150-248:0.25035):0.13454):0.00000):0.41439):0.10437,((Q6DE07_XENLA/176-277:0.45782,(Q8BGY4_MOUSE/156-257:0.36366,(Q6KAS2_MOUSE/175-277:0.18171,Q8N4N3_HUMAN/148-250:0.00000):0.33330):0.09504):0.13819,(Q6Q7X9_BRARE/173-274:0.16925,Q8BWA5_MOUSE/172-273:0.22714):0.30937):0.03972):0.16847):0.05246):0.01952,(((((((O18147_CAEEL/153-255:0.51007,O61795_CAEEL/158-260:0.36723):0.12430,Q6DJ21_XENTR/98-200:0.39318):0.12537,Q6NRH0_XENLA/125-227:0.32843):0.09857,KLHL8_MOUSE/178-280:0.47385):0.09205,(Q18670_CAEEL/173-275:0.56525,((KELC_DROME/258-360:0.30225,KELC_ANOST/201-303:0.17879):0.09967,(KLHL2_HUMAN/158-260:0.17876,Q8N4I8_HUMAN/152-254:0.17571):0.19205):0.08420):0.06564):0.05251,(Q6DFF6_XENLA/165-267:0.32921,(Q7Q1T2_ANOGA/174-276:0.33369,KLH17_MOUSE/192-294:0.20937):0.05754):0.08348):0.07767,(((Q7PXP7_ANOGA/216-318:0.11422,Q86BQ6_DROME/179-281:0.21807):0.16618,((Q6PGA3_MOUSE/223-324:0.22455,Q8CCY1_MOUSE/317-418:0.21994):0.10321,Q6PFE1_MOUSE/275-376:0.15200):0.20325):0.13335,((KLH18_HUMAN/75-177:0.11757,Q6IQ87_BRARE/140-242:0.18224):0.23839,(Q7QHD7_ANOGA/142-244:0.20806,Q9VGE5_DROME/143-245:0.28745):0.13194):0.06233):0.04679):0.06036):0.04781);
DTP  (((Q6PF15_HUMAN/9-111,(KLHL6_MOUSE/163-265,Q8AW66_BRARE/167-269)),(Q6NRT8_XENLA/167-269,Q7SYC4_BRARE/168-270)),((((Q6INL2_XENLA/135-237,Q6ZUS1_HUMAN/117-219),(Q5SY28_HUMAN/138-239,Q6NYM1_BRARE/140-242)),Q8BSF5_MOUSE/136-237),((ENC1_HUMAN/149-251,(Q6GNW3_XENLA/149-250,Q6TEQ2_BRARE/149-251)),(Q6DFF7_XENLA/149-251,Q8R2P1_MOUSE/149-251))),(((((Q8IQ29_DROME/76-176,Q9D618_MOUSE/131-233),((((((((((Q8JU17_LSDV/121-220,Q8JTM8_LSDV/120-221),Q8JTN6_LSDV/122-221),O72746_COWPX/102-200),(O72736_COWPX/123-222,((Q9DHH3_YLDV/126-228,Q8V3G0_SWPV/125-224),Q9Q8G2_9POXV/125-224))),P87597_COWPX/101-204),Q6N066_HUMAN/154-256),Q8NFY9_HUMAN/126-229),(Q6GQU2_MOUSE/139-240,Q6IR89_XENLA/133-234)),BTBD5_MOUSE/137-239),((KBTBA_HUMAN/135-237,Q6P4N4_XENTR/135-237),Q7SYD2_BRARE/136-238))),(Q6GKZ1_DROME/195-298,(Q9W6R2_FUGRU/75-177,Q9W6R3_FUGRU/76-178))),((((((Q6AX46_XENLA/177-277,Q9DB72_MOUSE/169-269),(Q7QAK9_ANOGA/104-206,Q7KSF5_DROME/192-294)),(KEAP1_RAT/184-286,Q8JIM0_BRARE/160-262)),Q8CA72_MOUSE/133-235),((IPP_MOUSE/139-241,Q6GNZ5_XENLA/139-241),(Q7PMB5_ANOGA/142-244,Q9VK21_DROME/187-289))),((((Q9W4L5_DROME/162-265,(Q8IH95_DROME/224-325,Q9V755_DROME/214-317)),Q9W4S3_DROME/306-407),(O16313_CAEEL/170-270,((Q6GML3_BRARE/142-241,Q8C2V5_MOUSE/142-240),((Q7QIC9_ANOGA/141-242,Q7QI84_ANOGA/148-248),Q9W2S3_DROME/150-248)))),((Q6DE07_XENLA/176-277,(Q8BGY4_MOUSE/156-257,(Q6KAS2_MOUSE/175-277,Q8N4N3_HUMAN/148-250))),(Q6Q7X9_BRARE/173-274,Q8BWA5_MOUSE/172-273))))),(((((((O18147_CAEEL/153-255,O61795_CAEEL/158-260),Q6DJ21_XENTR/98-200),Q6NRH0_XENLA/125-227),KLHL8_MOUSE/178-280),(Q18670_CAEEL/173-275,((KELC_DROME/258-360,KELC_ANOST/201-303),(KLHL2_HUMAN/158-260,Q8N4I8_HUMAN/152-254)))),(Q6DFF6_XENLA/165-267,(Q7Q1T2_ANOGA/174-276,KLH17_MOUSE/192-294))),(((Q7PXP7_ANOGA/216-318,Q86BQ6_DROME/179-281),((Q6PGA3_MOUSE/223-324,Q8CCY1_MOUSE/317-418),Q6PFE1_MOUSE/275-376)),((KLH18_HUMAN/75-177,Q6IQ87_BRARE/140-242),(Q7QHD7_ANOGA/142-244,Q9VGE5_DROME/143-245))))));
DTL  38.7636
RID  0.278871
RPH  ((((((((((((((((BTBD5_MOUSE/137-239:0.62085,((((((Q5SY28_HUMAN/138-239:0.31937,Q6NYM1_BRARE/140-242:0.23939):0.72961,KLH17_MOUSE/192-294:0.06674):0.24527,(Q18670_CAEEL/173-275:0.76461,((KELC_DROME/258-360:0.30574,KELC_ANOST/201-303:0.13737):0.20626,(KLHL2_HUMAN/158-260:0.12082,Q8N4I8_HUMAN/152-254:0.15049):0.12693):0.11789):0.16844):0.10942,((Q7PXP7_ANOGA/216-318:0.18543,Q86BQ6_DROME/179-281:0.18910):0.31727,((Q6PGA3_MOUSE/223-324:0.19473,Q8CCY1_MOUSE/317-418:0.21310):0.05109,Q6PFE1_MOUSE/275-376:0.14653):0.23700):0.24429):0.09008,(Q6NRH0_XENLA/125-227:0.57838,((O61795_CAEEL/158-260:0.37409,Q7Q1T2_ANOGA/174-276:0.36632):0.18605,Q6DFF6_XENLA/165-267:0.24927):0.06076):0.00000):0.06599,(Q8BSF5_MOUSE/136-237:0.91752,((Q6PF15_HUMAN/9-111:0.63641,(Q6NRT8_XENLA/167-269:0.17904,Q7SYC4_BRARE/168-270:0.19310):0.18727):0.08368,(KLHL6_MOUSE/163-265:0.32275,Q8AW66_BRARE/167-269:0.19286):0.36663):0.14617):0.12340):0.10412):0.09714,(((O18147_CAEEL/153-255:0.67917,KLHL8_MOUSE/178-280:0.74604):0.07162,Q6DJ21_XENTR/98-200:0.62191):0.12419,((KLH18_HUMAN/75-177:0.05065,Q6IQ87_BRARE/140-242:0.19232):0.31904,(Q7QHD7_ANOGA/142-244:0.26034,Q9VGE5_DROME/143-245:0.28652):0.14163):0.10201):0.11848):0.04740,(((ENC1_HUMAN/149-251:0.32228,(Q6GNW3_XENLA/149-250:0.30797,Q6TEQ2_BRARE/149-251:0.19691):0.16174):0.15486,(Q6DFF7_XENLA/149-251:0.09992,Q8R2P1_MOUSE/149-251:0.31393):0.06271):0.52347,(Q6IR89_XENLA/133-234:0.63121,Q6N066_HUMAN/154-256:0.76208):0.17805):0.19191):0.08585,((IPP_MOUSE/139-241:0.22832,Q6GNZ5_XENLA/139-241:0.17607):0.41454,(Q7PMB5_ANOGA/142-244:0.15839,Q9VK21_DROME/187-289:0.26594):0.51072):0.26267):0.08800,((Q6INL2_XENLA/135-237:0.36123,Q6ZUS1_HUMAN/117-219:0.47322):0.44127,((KBTBA_HUMAN/135-237:0.12648,Q6P4N4_XENTR/135-237:0.12831):0.11094,Q7SYD2_BRARE/136-238:0.21186):0.52408):0.19841):0.06186,(Q8NFY9_HUMAN/126-229:0.65420,Q9D618_MOUSE/131-233:0.71861):0.15723):0.09700,((Q7QAK9_ANOGA/104-206:0.11802,Q7KSF5_DROME/192-294:0.11937):0.25961,(KEAP1_RAT/184-286:0.15557,Q8JIM0_BRARE/160-262:0.37784):0.38196):0.21089):0.05114,((Q6GKZ1_DROME/195-298:0.80642,(Q9W6R2_FUGRU/75-177:0.39562,Q9W6R3_FUGRU/76-178:0.46713):0.38026):0.03889,(Q6GQU2_MOUSE/139-240:0.82981,Q8CA72_MOUSE/133-235:0.68863):0.13696):0.11203):0.12049,(Q8JU17_LSDV/121-220:0.81250,Q8IQ29_DROME/76-176:1.30765):0.38050):0.17293,(P87597_COWPX/101-204:0.78097,((O72746_COWPX/102-200:0.77120,(Q8JTM8_LSDV/120-221:0.73477,Q8JTN6_LSDV/122-221:0.47289):0.23569):0.15980,(O72736_COWPX/123-222:0.48299,((Q8V3G0_SWPV/125-224:0.62352,Q9Q8G2_9POXV/125-224:0.44298):0.17888,Q9DHH3_YLDV/126-228:0.47091):0.35501):0.41377):0.26058):0.19124):0.11216,(Q9W4L5_DROME/162-265:0.81432,((Q8IH95_DROME/224-325:0.52199,Q9V755_DROME/214-317:0.47512):0.28976,Q9W4S3_DROME/306-407:0.58100):0.07543):0.59543):0.11420,((Q6AX46_XENLA/177-277:0.00421,Q9DB72_MOUSE/169-269:0.53430):1.07480,((Q6GML3_BRARE/142-241:0.23667,Q8C2V5_MOUSE/142-240:0.30776):0.12935,(O16313_CAEEL/170-270:0.79382,(Q9W2S3_DROME/150-248:0.29336,(Q7QI84_ANOGA/148-248:0.19630,Q7QIC9_ANOGA/141-242:0.54664):0.24022):0.15829):0.13823):0.43130):0.42861):0.21458,(Q6Q7X9_BRARE/173-274:0.09009,Q8BWA5_MOUSE/172-273:0.18645):0.48031):0.30164,Q6DE07_XENLA/176-277:0.34132):0.25467,Q8BGY4_MOUSE/156-257:0.42327):0.89528,Q6KAS2_MOUSE/175-277:0.20417,Q8N4N3_HUMAN/148-250:0.04512);
RTP  ((((((((((((((((BTBD5_MOUSE/137-239,((((((Q5SY28_HUMAN/138-239,Q6NYM1_BRARE/140-242),KLH17_MOUSE/192-294),(Q18670_CAEEL/173-275,((KELC_DROME/258-360,KELC_ANOST/201-303),(KLHL2_HUMAN/158-260,Q8N4I8_HUMAN/152-254)))),((Q7PXP7_ANOGA/216-318,Q86BQ6_DROME/179-281),((Q6PGA3_MOUSE/223-324,Q8CCY1_MOUSE/317-418),Q6PFE1_MOUSE/275-376))),(Q6NRH0_XENLA/125-227,((O61795_CAEEL/158-260,Q7Q1T2_ANOGA/174-276),Q6DFF6_XENLA/165-267))),(Q8BSF5_MOUSE/136-237,((Q6PF15_HUMAN/9-111,(Q6NRT8_XENLA/167-269,Q7SYC4_BRARE/168-270)),(KLHL6_MOUSE/163-265,Q8AW66_BRARE/167-269))))),(((O18147_CAEEL/153-255,KLHL8_MOUSE/178-280),Q6DJ21_XENTR/98-200),((KLH18_HUMAN/75-177,Q6IQ87_BRARE/140-242),(Q7QHD7_ANOGA/142-244,Q9VGE5_DROME/143-245)))),(((ENC1_HUMAN/149-251,(Q6GNW3_XENLA/149-250,Q6TEQ2_BRARE/149-251)),(Q6DFF7_XENLA/149-251,Q8R2P1_MOUSE/149-251)),(Q6IR89_XENLA/133-234,Q6N066_HUMAN/154-256))),((IPP_MOUSE/139-241,Q6GNZ5_XENLA/139-241),(Q7PMB5_ANOGA/142-244,Q9VK21_DROME/187-289))),((Q6INL2_XENLA/135-237,Q6ZUS1_HUMAN/117-219),((KBTBA_HUMAN/135-237,Q6P4N4_XENTR/135-237),Q7SYD2_BRARE/136-238))),(Q8NFY9_HUMAN/126-229,Q9D618_MOUSE/131-233)),((Q7QAK9_ANOGA/104-206,Q7KSF5_DROME/192-294),(KEAP1_RAT/184-286,Q8JIM0_BRARE/160-262))),((Q6GKZ1_DROME/195-298,(Q9W6R2_FUGRU/75-177,Q9W6R3_FUGRU/76-178)),(Q6GQU2_MOUSE/139-240,Q8CA72_MOUSE/133-235))),(Q8JU17_LSDV/121-220,Q8IQ29_DROME/76-176)),(P87597_COWPX/101-204,((O72746_COWPX/102-200,(Q8JTM8_LSDV/120-221,Q8JTN6_LSDV/122-221)),(O72736_COWPX/123-222,((Q8V3G0_SWPV/125-224,Q9Q8G2_9POXV/125-224),Q9DHH3_YLDV/126-228))))),(Q9W4L5_DROME/162-265,((Q8IH95_DROME/224-325,Q9V755_DROME/214-317),Q9W4S3_DROME/306-407))),((Q6AX46_XENLA/177-277,Q9DB72_MOUSE/169-269),((Q6GML3_BRARE/142-241,Q8C2V5_MOUSE/142-240),(O16313_CAEEL/170-270,(Q9W2S3_DROME/150-248,(Q7QI84_ANOGA/148-248,Q7QIC9_ANOGA/141-242)))))),(Q6Q7X9_BRARE/173-274,Q8BWA5_MOUSE/172-273)),Q6DE07_XENLA/176-277),Q8BGY4_MOUSE/156-257),Q6KAS2_MOUSE/175-277,Q8N4N3_HUMAN/148-250);
RTL  54.1132
LNK  BTBD5_MOUSE/137-239:Q9CR40:AK002637
LNK  ENC1_HUMAN/149-251:O14682:AF005381
LNK  IPP_MOUSE/139-241:P28575:AF285178
LNK  KBTB9_MOUSE/216-318:Q80T74:
LNK  KBTBA_HUMAN/135-237:O60662:AF056929
LNK  KEAP1_RAT/184-286:P57790:AF304364
LNK  KELC_ANOST/201-303:Q70JS2:AJ577207
LNK  KELC_DROME/258-360:Q04652:L08483
LNK  KLH17_MOUSE/192-294:Q6TDP3:AY423764
LNK  KLH18_HUMAN/75-177:O94889:AB062478
LNK  KLHL2_HUMAN/158-260:O95198:AF059569
LNK  KLHL6_MOUSE/163-265:Q6V595:AY350736
LNK  KLHL8_MOUSE/178-280:P59280:AK049960
LNK  O16313_CAEEL/170-270:O16313:AF016430
LNK  O18147_CAEEL/153-255:O18147:Z82059
LNK  O61795_CAEEL/158-260:O61795:AF067219
LNK  O72736_COWPX/123-222:O72736:X94355
LNK  O72746_COWPX/102-200:O72746:X94355
LNK  P87597_COWPX/101-204:P87597:X94355
LNK  Q18670_CAEEL/173-275:Q18670:Z69902
LNK  Q5SY28_HUMAN/138-239:Q5SY28:AL591866
LNK  Q6AX46_XENLA/177-277:Q6AX46:BC079765
LNK  Q6DE07_XENLA/176-277:Q6DE07:BC077340
LNK  Q6DFF6_XENLA/165-267:Q6DFF6:BC076782
LNK  Q6DFF7_XENLA/149-251:Q6DFF7:BC076781
LNK  Q6DJ21_XENTR/98-200:Q6DJ21:BC075364
LNK  Q6GKZ1_DROME/195-298:Q6GKZ1:BT014923
LNK  Q6GML3_BRARE/142-241:Q6GML3:BC074031
LNK  Q6GNW3_XENLA/149-250:Q6GNW3:BC073388
LNK  Q6GNZ5_XENLA/139-241:Q6GNZ5:BC073355
LNK  Q6GQU2_MOUSE/139-240:Q6GQU2:BC072626
LNK  Q6INL2_XENLA/135-237:Q6INL2:BC072268
LNK  Q6IQ87_BRARE/140-242:Q6IQ87:BC071523
LNK  Q6IR89_XENLA/133-234:Q6IR89:BC071011
LNK  Q6KAS2_MOUSE/175-277:Q6KAS2:AK131135
LNK  Q6N066_HUMAN/154-256:Q6N066:BX640672
LNK  Q6NRH0_XENLA/125-227:Q6NRH0:BC070780
LNK  Q6NRT8_XENLA/167-269:Q6NRT8:BC070629
LNK  Q6NYM1_BRARE/140-242:Q6NYM1:BC066537
LNK  Q6P4N4_XENTR/135-237:Q6P4N4:BC063333
LNK  Q6PF15_HUMAN/9-111:Q6PF15:BC057763
LNK  Q6PFE1_MOUSE/275-376:Q6PFE1:BC057606
LNK  Q6PGA3_MOUSE/223-324:Q6PGA3:BC057137
LNK  Q6Q7X9_BRARE/173-274:Q6Q7X9:AY553639
LNK  Q6TEQ2_BRARE/149-251:Q6TEQ2:AY422997
LNK  Q6ZUS1_HUMAN/117-219:Q6ZUS1:AK125364
LNK  Q7KSF5_DROME/192-294:Q7KSF5:AE003716
LNK  Q7PMB5_ANOGA/142-244:Q7PMB5:AAAB01008980
LNK  Q7PXP7_ANOGA/216-318:Q7PXP7:AAAB01008987
LNK  Q7Q1T2_ANOGA/174-276:Q7Q1T2:AAAB01008980
LNK  Q7QAK9_ANOGA/104-206:Q7QAK9:AAAB01008888
LNK  Q7QHD7_ANOGA/142-244:Q7QHD7:AAAB01008816
LNK  Q7QI84_ANOGA/148-248:Q7QI84:AAAB01008807
LNK  Q7QIC9_ANOGA/141-242:Q7QIC9:AAAB01008807
LNK  Q7SYC4_BRARE/168-270:Q7SYC4:BC054921
LNK  Q7SYD2_BRARE/136-238:Q7SYD2:BC054912
LNK  Q7ZVF7_BRARE/174-276:Q7ZVF7:
LNK  Q86BQ6_DROME/179-281:Q86BQ6:AE003446
LNK  Q8AW66_BRARE/167-269:Q8AW66:AL591589
LNK  Q8BGY4_MOUSE/156-257:Q8BGY4:AK041089
LNK  Q8BSF5_MOUSE/136-237:Q8BSF5:AK033353
LNK  Q8BWA5_MOUSE/172-273:Q8BWA5:AK053085
LNK  Q8C2V5_MOUSE/142-240:Q8C2V5:AK087881
LNK  Q8CA72_MOUSE/133-235:Q8CA72:AK039455
LNK  Q8CCY1_MOUSE/317-418:Q8CCY1:AK031932
LNK  Q8IH95_DROME/224-325:Q8IH95:BT001353
LNK  Q8IQ29_DROME/76-176:Q8IQ29:AE003571
LNK  Q8JIM0_BRARE/160-262:Q8JIM0:AB081315
LNK  Q8JTM8_LSDV/120-221:Q8JTM8:AF409138
LNK  Q8JTN6_LSDV/122-221:Q8JTN6:AF409138
LNK  Q8JU17_LSDV/121-220:Q8JU17:AF409137
LNK  Q8N4I8_HUMAN/152-254:Q8N4I8:BC034035
LNK  Q8N4N3_HUMAN/148-250:Q8N4N3:BC033821
LNK  Q8NFY9_HUMAN/126-229:Q8NFY9:AF385438
LNK  Q8R2P1_MOUSE/149-251:Q8R2P1:BC027373
LNK  Q8V3G0_SWPV/125-224:Q8V3G0:AF410153
LNK  Q9D618_MOUSE/131-233:Q9D618:AK014702
LNK  Q9DB72_MOUSE/169-269:Q9DB72:AK005160
LNK  Q9DHH3_YLDV/126-228:Q9DHH3:AJ293568
LNK  Q9Q8G2_9POXV/125-224:Q9Q8G2:AF170726
LNK  Q9V755_DROME/214-317:Q9V755:AE003813
LNK  Q9VGE5_DROME/143-245:Q9VGE5:AE003694
LNK  Q9VK21_DROME/187-289:Q9VK21:AE003639
LNK  Q9W2S3_DROME/150-248:Q9W2S3:AE003451
LNK  Q9W4L5_DROME/162-265:Q9W4L5:AE003430
LNK  Q9W4S3_DROME/306-407:Q9W4S3:AE003427
LNK  Q9W6R2_FUGRU/75-177:Q9W6R2:AF146687
LNK  Q9W6R3_FUGRU/76-178:Q9W6R3:AF146687
AMK  xxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxx.xxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxx.xxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9W6R3_FUGRU/76-178
ASQ  CIDIYQLTKYN.FCTQLEQKAYKFILNNFDLIESGE.EFFQ.LDMEHFCSIIASDHLCVSSEAVVFRAVVRWINHAVADRKEFTAILF.SKVRL.CFLSYEYIRLNML
DSQ  TGCATCGACATCTACCAGCTGACCAAATACAAC...TTCTGCACCCAACTGGAGCAAAAGGCATACAAATTCATTCTAAATAACTTTGACTTGATTGAATCGGGTGAA...GAGTTCTTTCAA...CTTGATATGGAGCATTTCTGCAGCATAATTGCCAGCGATCATCTTTGTGTGAGTAGTGAGGCTGTTGTCTTCAGGGCTGTTGTTCGGTGGATCAACCATGCAGTGGCAGACAGAAAAGAATTCACAGCCATTCTATTT...TCCAAGGTCCGGCTA...TGTTTTTTATCTTATGAATACATCCGCCTCAATATGCTG
TRN  10010101100011010
NAM  Q9W6R2_FUGRU/75-177
ASQ  CIGIWQFSDIC.YCSQLQEKAFEFILCNFDQVISSK.EFHQ.LSVEELCDIFDHDELNVKNESIVFEAICKWISHNSERRKRHFAILL.PKVRL.ALLSLEYIITNMV
DSQ  TGCATCGGCATCTGGCAGTTCAGCGACATCTGC...TACTGCTCCCAACTGCAGGAAAAGGCATTCGAGTTTATCCTTTGTAACTTTGATCAAGTTATTTCCAGTAAG...GAGTTCCATCAG...TTGTCTGTGGAGGAACTTTGCGACATCTTTGACCACGATGAACTTAATGTGAAAAATGAGAGCATTGTGTTTGAGGCCATCTGTAAATGGATCAGTCACAATTCTGAAAGAAGAAAGAGACATTTTGCAATACTCTTG...CCAAAGGTCCGACTG...GCTTTGTTGAGTTTAGAGTACATCATCACCAACATGGTT
TRN  10010101100011010
NAM  Q9VK21_DROME/187-289
ASQ  ALGILRFAEAH.NCESLAKSALNFVHANFPAVTLED.EFLE.TPQTLLSQLLNSELLRVDSESQVFQAALRWIKHDVTQRRCYVFDVL.SHVRM.ALVPVKVIDKALK
DSQ  GCCCTGGGCATTTTACGCTTCGCCGAGGCCCAC...AACTGCGAGTCGTTGGCCAAGAGTGCACTGAACTTTGTCCACGCGAATTTCCCAGCGGTAACGCTTGAAGAT...GAGTTCCTAGAA...ACGCCACAAACTCTACTCTCGCAGCTACTGAACTCGGAGCTGCTGCGTGTAGACTCCGAGTCGCAGGTGTTCCAGGCGGCGCTTCGTTGGATTAAGCACGACGTGACGCAGCGCCGCTGCTACGTCTTCGATGTCCTG...TCCCACGTGCGCATG...GCGCTTGTTCCGGTAAAGGTGATCGACAAGGCTCTGAAG
TRN  11011111101111110
NAM  Q7PMB5_ANOGA/142-244
ASQ  ALGILRFAEAH.NCRQLAEVAANFVHSNFPKVALED.ELLD.IPHTLLVKVIASEALRVDSEYQVFNAALRWIRHDVVPRRQYVFEIL.SHVRI.ALVPVGLIDQAIA
DSQ  GCGCTTGGCATACTGCGATTTGCCGAAGCGCAC...AACTGCCGCCAGCTTGCCGAGGTGGCGGCCAACTTTGTCCACAGCAACTTTCCGAAGGTCGCCCTCGAGGAC...GAACTGCTCGAC...ATTCCGCACACGCTGCTGGTGAAGGTGATCGCCTCCGAGGCGCTGCGGGTCGACAGCGAGTATCAGGTGTTTAATGCCGCGCTGCGCTGGATCCGACACGATGTGGTGCCGCGCCGCCAGTACGTGTTTGAAATTTTG...TCCCACGTGCGCATC...GCTCTAGTGCCGGTAGGGCTAATCGATCAGGCCATCGCC
TRN  10010111100111011
NAM  Q6GNZ5_XENLA/139-241
ASQ  CIGFFQFAEHL.ACHPLLEFTESYIHTHFTEVQTGD.EFPT.LTKDQLVQILQNEELCIEDEYQVFSAAMTWIQKDIVTRKRHVIEVL.EPVRF.SLLPPKRLQKAIE
DSQ  TGTATAGGCTTCTTCCAGTTTGCAGAGCATCTA...GCCTGCCATCCACTGCTTGAGTTTACTGAAAGTTATATCCACACACATTTTACAGAGGTGCAGACTGGGGAT...GAATTTCCAACC...CTGACTAAGGATCAGCTTGTACAAATTTTACAAAACGAGGAGCTCTGCATTGAAGATGAATACCAAGTTTTCTCTGCTGCAATGACATGGATCCAGAAGGACATTGTCACACGAAAGAGACATGTTATTGAAGTGTTG...GAGCCAGTACGTTTT...TCATTATTACCTCCAAAAAGACTTCAAAAAGCTATTGAA
TRN  10010101100011000
NAM  IPP_MOUSE/139-241
ASQ  CIGLFQFSEQI.ACHDLLEFTENYIHSIFLEVHTGE.EFLG.LTKDQLIKILRSEELSIEDEYQVFLAAMQWILKDLGKRRKHVVEVL.DPVRF.PLLPSQRLLKYIE
DSQ  TGCATTGGACTCTTTCAGTTCTCTGAGCAAATT...GCCTGCCATGATCTTTTGGAATTTACAGAAAATTATATTCATTCCATTTTCTTGGAGGTTCATACTGGGGAA...GAGTTCCTCGGG...CTTACAAAAGATCAGCTGATCAAAATTTTACGAAGTGAAGAGCTTAGCATTGAAGATGAATACCAAGTCTTCTTAGCTGCAATGCAGTGGATTCTTAAAGACCTGGGAAAGAGAAGAAAACATGTGGTGGAAGTATTA...GATCCAGTTCGATTC...CCCTTGTTACCATCTCAGAGGCTTTTAAAGTACATAGAA
TRN  10010101100011010
NAM  Q9VGE5_DROME/143-245
ASQ  VLGIRTFADSM.ICRQLIDAADKYIDQNFAKVSQSE.EFLA.LDCEQLLELMRRDELNVRTEEVIFEACMKWVKYAEDKRSELFPQVL.AAVRL.PLLSPQFLADRVA
DSQ  GTCCTGGGAATCCGCACCTTCGCCGACTCCATG...ATCTGCCGGCAGCTAATCGACGCTGCCGACAAGTATATTGATCAAAACTTTGCCAAAGTCTCGCAGTCGGAG...GAGTTTCTCGCC...CTGGACTGCGAACAATTGCTGGAGCTGATGCGCCGGGACGAACTCAACGTACGCACCGAGGAGGTCATCTTCGAGGCCTGCATGAAGTGGGTCAAGTACGCAGAAGACAAGCGCTCTGAGCTCTTTCCTCAGGTCCTG...GCTGCAGTGCGTTTG...CCATTGCTCTCGCCTCAGTTCCTGGCGGACCGTGTGGCC
TRN  11011101101011011
NAM  Q7QHD7_ANOGA/142-244
ASQ  VLGIRQFADTL.GCSKLIVSADRYIHQHFSKVAAGD.EFVA.LSYSELIDVIGRDELNVKSEECIFEACMRWVKHEQETRSEYLPLIL.ANIRL.PLLSPQFLADSVA
DSQ  GTGCTCGGCATTCGGCAGTTTGCCGACACGCTC...GGCTGCTCGAAGCTGATCGTGTCCGCCGACCGGTACATCCACCAGCACTTTTCAAAAGTGGCCGCTGGGGAT...GAGTTTGTGGCG...CTCAGCTACAGCGAGCTGATCGATGTGATCGGCCGCGACGAGCTGAACGTCAAGAGCGAAGAGTGCATTTTCGAGGCGTGCATGCGCTGGGTAAAGCACGAGCAGGAAACCCGCTCCGAGTATTTGCCGCTCATACTG...GCCAACATACGGCTG...CCGCTGCTGTCGCCCCAGTTCCTCGCGGACAGTGTGGCG
TRN  10010101100011001
NAM  Q6IQ87_BRARE/140-242
ASQ  CLGVRQFAETM.MCTTLYDAANSFVHQHFVEVSVSE.EFLA.LRPEEVLELVGCDELNVQAEEQVFEAVLAWVRHERDDRESRLPELL.SKIRL.PLCRPQFLADRVQ
DSQ  TGCCTCGGTGTGCGGCAGTTTGCTGAGACTATG...ATGTGTACCACACTATACGATGCAGCCAACAGCTTCGTTCACCAGCACTTTGTGGAGGTGTCTGTGTCTGAG...GAGTTTCTGGCC...CTTCGGCCGGAGGAGGTGCTTGAGCTGGTGGGCTGCGATGAGCTCAACGTCCAAGCAGAAGAGCAGGTGTTTGAGGCAGTGTTGGCTTGGGTGCGACACGAACGTGATGATAGGGAGTCACGTTTACCGGAGTTACTG...TCTAAAATCAGACTA...CCTTTATGTCGGCCTCAGTTTCTGGCAGACCGAGTCCAG
TRN  10010101100011000
NAM  KLH18_HUMAN/75-177
ASQ  CLGVRQFAETM.MCAVLYDAANSFIHQHFVEVSMSE.EFLA.LPLEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPYLPELL.SNIRL.PLCRPQFLSDRVQ
DSQ  TGCCTGGGTGTGCGCCAGTTTGCTGAGACAATG...ATGTGTGCTGTGCTGTACGACGCTGCCAACAGCTTCATCCACCAGCACTTTGTGGAGGTGTCCATGTCAGAA...GAGTTCCTGGCC...CTGCCCTTGGAAGACGTGCTTGAGCTGGTGTCTCGGGATGAGCTGAATGTCAAATCTGAGGAGCAGGTCTTTGAAGCTGCATTGGCCTGGGTCAGATACGACCGGGAGCAGAGGGGTCCCTACCTGCCTGAGCTGCTG...TCCAATATCCGCCTG...CCCCTCTGTCGGCCCCAGTTCCTTTCAGACAGAGTACAG
TRN  10010101100011001
NAM  Q8N4I8_HUMAN/152-254
ASQ  CLGIRAFADVH.TCTDLLQQANAYAEQHFPEVMLGE.EFLS.LSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLM.EHVRL.PLLPRDYLVQTVE
DSQ  TGCCTGGGCATCCGTGCGTTTGCAGATGTACAC...ACCTGCACTGACCTTCTGCAGCAGGCCAATGCCTACGCAGAGCAGCACTTTCCAGAGGTGATGCTAGGAGAA...GAATTTCTTAGC...CTGAGTCTGGACCAGGTGTGCAGCTTGATATCCAGCGACAAGCTGACCGTTTCTTCAGAAGAGAAGGTGTTTGAAGCTGTGATCTCATGGATCAATTATGAGAAAGAAACCCGTTTAGAGCACATGGCAAAGCTGATG...GAACATGTCCGACTT...CCTCTCTTACCTAGGGACTACCTAGTCCAAACGGTTGAA
TRN  10010101100011000
NAM  KLHL2_HUMAN/158-260
ASQ  CLGIRAFADMH.ACTDLLNKANTYAEQHFADVVLSE.EFLN.LGIEQVCSLISSDKLTISSEEKVFEAVIAWVNHDKDVRQEFMARLM.EHVRL.PLLPREYLVQRVE
DSQ  TGCTTAGGAATCCGGGCTTTTGCTGATATGCAT...GCATGTACCGACCTTCTGAACAAGGCCAACACCTATGCAGAGCAACATTTTGCAGATGTTGTACTTAGTGAA...GAATTTCTCAAT...CTTGGCATCGAACAAGTGTGCAGCTTAATCTCAAGTGACAAACTTACCATTTCTTCAGAAGAGAAGGTATTTGAAGCAGTAATAGCATGGGTGAACCATGACAAGGATGTGAGGCAAGAGTTTATGGCCCGACTGATG...GAACATGTACGGTTA...CCTTTGCTTCCTCGGGAATATTTAGTTCAGAGGGTTGAA
TRN  10010101100011000
NAM  KELC_ANOST/201-303
ASQ  CLGIRDFADIH.GCIDLLNYAETYIEQHFSEVVQFD.EFLN.LTSDQVAHLIKSDRLSVPTEEKVYECVITWIQYDVNGRQHHLAELM.EHVRL.PLLSQDYLVQYVE
DSQ  TGTTTGGGCATTCGGGATTTTGCCGACATTCAC...GGATGCATCGATTTACTGAACTATGCAGAAACGTACATCGAGCAGCATTTCTCGGAGGTTGTGCAGTTTGAC...GAGTTTCTTAAT...CTTACCAGCGATCAGGTGGCTCATTTGATCAAGAGTGACCGTTTGTCGGTTCCAACAGAAGAAAAGGTCTACGAATGCGTCATCACCTGGATACAGTACGACGTGAACGGCCGCCAGCACCACCTGGCCGAGCTGATG...GAGCATGTCCGCTTA...CCCTTGCTCTCGCAGGACTATCTCGTGCAGTACGTCGAG
TRN  10010111100111010
NAM  KELC_DROME/258-360
ASQ  CLGIREFADIH.ACVELLNYAETYIEQHFNEVIQFD.EFLN.LSHEQVISLIGNDRISVPNEERVYECVIAWLRYDVPMREQFTSLLM.EHVRL.PFLSKEYITQRVD
DSQ  TGCCTCGGCATCCGGGAGTTTGCCGATATTCAT...GCCTGCGTGGAACTTCTCAATTACGCAGAGACCTACATCGAGCAGCATTTCAACGAGGTGATCCAGTTCGAT...GAGTTTCTGAAC...CTCTCGCACGAGCAGGTCATCAGCCTGATTGGCAACGACCGGATTTCGGTTCCAAATGAGGAGCGCGTATACGAGTGCGTCATCGCCTGGCTGCGCTACGATGTTCCTATGCGGGAACAGTTCACCTCGTTGCTCATG...GAGCATGTGCGTCTG...CCGTTCCTGTCCAAGGAGTACATCACACAACGTGTGGAC
TRN  11011111101111111
NAM  KLH17_MOUSE/192-294
ASQ  CLGIRGFADTH.SCSDLLKAAHRYVLQHFVDVAKTE.EFML.LPLKQVLELVSSDSLNVPSEEDVYRAVLSWVKHDVDTRRQHVPRLM.KCVRL.PLLSRDFLLGHVD
DSQ  TGCCTGGGCATTCGAGGATTTGCAGACACACAC...TCATGCAGTGACCTGCTCAAGGCAGCACACAGGTACGTGCTGCAGCACTTCGTGGATGTGGCCAAGACTGAG...GAGTTCATGCTG...TTGCCACTGAAGCAGGTGCTGGAATTGGTCTCTAGTGATAGCCTGAACGTGCCCTCAGAGGAAGATGTGTACCGTGCAGTCCTGAGCTGGGTCAAACATGACGTAGACACTCGGAGGCAGCATGTACCAAGGTTGATG...AAGTGTGTACGGCTG...CCTCTGCTGAGCCGAGACTTCCTCCTGGGCCACGTGGAT
TRN  10010101100011001
NAM  Q7Q1T2_ANOGA/174-276
ASQ  CLGIRSFADAH.SCKELHSRSHRYALQNFQQVVGTE.EFLL.LGFNEVQDLISNSQLNICSEEKVFMAVLNWVKHDLSERKKHISELM.SHVRL.PLVSREFLMNCVE
DSQ  TGTCTGGGAATTCGAAGCTTCGCCGATGCTCAC...TCGTGCAAGGAACTACACTCCCGATCCCACCGGTACGCCCTGCAGAACTTCCAGCAAGTCGTCGGCACGGAG...GAGTTTTTATTG...CTCGGATTTAATGAGGTGCAGGATTTGATTTCCAACAGCCAGCTAAACATCTGCTCGGAGGAGAAGGTGTTCATGGCGGTGCTGAACTGGGTGAAGCACGATCTCAGCGAGCGCAAGAAGCACATATCCGAGCTGATG...TCGCACGTCCGACTG...CCGCTAGTCAGCCGCGAATTTCTCATGAACTGCGTCGAA
TRN  10010111100111010
NAM  Q6DFF6_XENLA/165-267
ASQ  CLGIRAFADTH.SCRELLRIADKFTQHNFQEVMESE.EFML.LPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVL.QHVRL.PLLSPKFLVGTVG
DSQ  TGCTTGGGCATCCGAGCCTTCGCTGACACTCAC...TCGTGCCGAGAGCTGTTGAGGATTGCGGATAAGTTCACCCAGCATAACTTTCAGGAGGTGATGGAAAGTGAG...GAGTTTATGCTT...CTCCCAGCAAATCAGTTGATAGATATAATCTCAAGTGATGAACTGAATGTTCGCAGCGAAGAGCAAGTGTTCAATGCAGTGATGGCCTGGGTGAAATACAGCATTCAAGAAAGGAGGCCACAGCTACCACAAGTTCTG...CAACACGTTCGATTG...CCGCTTCTAAGCCCAAAATTTTTGGTGGGGACTGTTGGA
TRN  10010101100011001
NAM  O61795_CAEEL/158-260
ASQ  CLGIRAFADTH.SCKELLSSADEFALKNFSRVIGKE.EFQM.LTVESLTTIIKSDKLNAASEELVFSAVIQWVRHDISKRKTHLSMLL.SHVRL.PLCTPKFLVSVVS
DSQ  TGTCTTGGGATTCGAGCATTTGCGGATACACAT...TCCTGCAAAGAGCTCCTAAGTTCTGCAGATGAATTTGCACTGAAAAATTTCTCGAGAGTGATTGGAAAAGAG...GAATTTCAAATG...TTAACTGTGGAAAGCCTTACAACAATCATCAAAAGCGATAAACTCAATGCAGCTTCTGAAGAGCTAGTTTTTTCCGCAGTAATACAATGGGTCAGACATGATATTTCAAAAAGAAAAACTCATTTATCCATGCTGCTC...TCCCATGTCCGTCTG...CCTCTATGCACTCCGAAGTTCTTGGTGAGTGTGGTCAGT
TRN  10010101100011000
NAM  Q6NRH0_XENLA/125-227
ASQ  CLGIRDFAETH.NCLELMQAAEVYSQKHFPEVVQHE.EFML.LHQEEVEKLIHCDEIQINSEEPVFEAVINWVKHNRHEREKSLPQLL.QYVRM.PLLTPRYITDVID
DSQ  TGTTTGGGTATACGGGACTTTGCAGAGACCCAT...AATTGTCTAGAATTAATGCAGGCTGCTGAGGTTTATAGCCAGAAGCACTTCCCAGAGGTTGTACAACATGAA...GAGTTTATGCTT...TTGCATCAGGAGGAGGTGGAGAAACTAATACACTGTGATGAAATTCAGATCAACTCAGAGGAACCTGTATTTGAAGCGGTTATAAACTGGGTAAAACACAACAGACATGAGCGAGAGAAATCTCTTCCACAGCTTCTT...CAGTATGTACGCATG...CCACTTCTAACCCCACGCTACATTACAGATGTCATTGAT
TRN  10010101110011000
NAM  BTBD5_MOUSE/137-239
ASQ  CIGISRFAETY.GCHDLYLAATKFICQNFESVCQTE.EFFE.LTHADLDEIVSNDCLNVATEETVFYALESWIKYDVQERQKYLAQLL.NSVRL.PLLSVKFLTRLYE
DSQ  TGTATTGGAATTTCTCGTTTTGCGGAGACTTAC...GGTTGTCATGACCTTTATTTGGCGGCTACTAAATTCATATGCCAGAATTTTGAATCTGTTTGCCAGACAGAA...GAGTTTTTTGAG...CTTACACATGCTGATTTGGACGAAATTGTCTCCAATGACTGCTTGAATGTGGCTACTGAAGAGACAGTTTTTTATGCATTAGAATCTTGGATCAAGTACGATGTACAAGAACGGCAGAAGTACTTAGCCCAGCTGCTG...AACAGTGTACGGTTA...CCATTGCTGAGCGTTAAGTTCCTCACTAGGCTCTATGAA
TRN  10010101100011010
NAM  Q8CCY1_MOUSE/317-418
ASQ  CLGIRAFADAQ.GCIELMKVAHSYTMENIMEVIRNQ.EFLL.LPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQRRCSDLSMLL.AFIRL.PLLPPQILAD-LE
DSQ  TGTTTAGGAATAAGGGCATTTGCTGATGCTCAA...GGATGCATTGAATTAATGAAGGTGGCACACAGCTACACCATGGAAAACATAATGGAAGTAATCAGAAATCAA...GAGTTTTTACTC...CTTCCAGCTGAAGAGCTCCATAAACTACTGGCCAGTGATGATGTAAATGTTCCTGATGAAGAGACCATTTTCCATGCACTGATGATGTGGGTCAAGTATGACATGCAGCGGAGATGTAGTGACCTGAGTATGCTCCTT...GCCTTCATAAGATTA...CCACTGCTTCCACCACAGATACTGGCTGAC---CTTGAA
TRN  10010101100011010
NAM  Q6PFE1_MOUSE/275-376
ASQ  CLGIRSFADAQ.GCTDLHKVAHNYTMEHFMEVIRNQ.EFVL.LPANEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSRLL.AYIRL.PLLAPQFLAD-ME
DSQ  TGCCTGGGGATTCGGTCCTTCGCGGATGCCCAA...GGCTGCACAGATCTGCATAAAGTGGCTCACAATTACACGATGGAACATTTCATGGAAGTAATCAGGAACCAG...GAGTTTGTGTTA...CTCCCAGCCAATGAGATCGCCAAGCTCTTGGCCAGCGATGACATGAACATCCCGAACGAGGAGACCATACTGAACGCGCTTCTCACCTGGGTCCGGCACGACCTGGAGCAGAGGCGGAAGGATCTCAGTAGACTTTTG...GCTTACATTAGGCTA...CCTCTCCTTGCGCCACAGTTCCTGGCAGAC---ATGGAA
TRN  10010101100011010
NAM  Q6PGA3_MOUSE/223-324
ASQ  CLGIRSFGDAQ.GCMELQNVAHKYAMEHFIDVIKNQ.EFLL.LPANEISKLLCSDDINVPDEETIFHALMQWVGHDAQARQRDLAKLL.SYIRL.PLLSPQLLAD-LE
DSQ  TGCCTAGGGATTCGCTCATTTGGAGATGCACAG...GGCTGTATGGAGCTTCAGAATGTGGCACATAAGTATGCCATGGAACACTTCATTGATGTAATAAAGAACCAA...GAATTCCTGCTG...CTTCCAGCTAATGAAATATCAAAACTTCTGTGTAGTGATGACATTAATGTGCCTGATGAAGAAACAATTTTCCATGCTCTTATGCAGTGGGTAGGTCATGATGCTCAGGCTAGGCAACGAGATCTGGCAAAGCTGCTT...TCTTACATTAGACTG...CCATTACTCTCACCACAGTTGCTTGCAGAT---CTGGAA
TRN  10010101100011000
NAM  Q86BQ6_DROME/179-281
ASQ  CLGFAFFAEQQ.SCTTLLRLAQAYTCQYFMQVCQNQ.EFFQ.LNADQLGKLLSSDDLNVPSEQDVFHSLMSWVRHDSAAREQHIPELL.ALVRL.PLLQPAFIMDHVE
DSQ  TGCCTTGGGTTCGCCTTCTTTGCGGAGCAACAG...AGCTGCACCACGCTGCTGCGTCTGGCGCAGGCCTACACCTGCCAGTACTTTATGCAGGTGTGCCAGAATCAG...GAGTTCTTCCAG...CTGAACGCCGATCAGTTGGGCAAGCTGCTTAGCAGCGATGATCTCAATGTGCCCTCGGAGCAGGATGTCTTTCACAGTCTGATGTCGTGGGTGCGCCACGATTCCGCTGCCCGTGAGCAGCACATACCGGAGCTGTTG...GCCCTGGTGCGACTG...CCCCTACTGCAGCCAGCGTTTATCATGGACCACGTGGAG
TRN  10010111100111011
NAM  Q7PXP7_ANOGA/216-318
ASQ  CLGFSLFAEQQ.GCTALLKLATAYTCQHFQQVWKNQ.EFFM.LDAAQLANLLRSDDLNVPNEQEVFHALMAWIQYDAEGRKRHIPELL.ALIKL.PLLQPSFIVDHVE
DSQ  TGTCTCGGGTTTTCGCTGTTTGCCGAGCAGCAG...GGCTGCACGGCGCTGCTGAAGCTGGCGACCGCCTACACCTGCCAGCACTTCCAGCAGGTGTGGAAAAACCAG...GAGTTCTTCATG...CTGGACGCCGCCCAGCTCGCCAATCTGCTGCGCAGCGATGACCTGAACGTGCCGAACGAGCAGGAAGTGTTTCACGCGCTGATGGCCTGGATCCAGTACGACGCGGAGGGCCGCAAGCGGCACATCCCGGAGCTGTTG...GCACTGATCAAGCTG...CCACTGTTGCAACCTTCGTTCATAGTGGATCACGTGGAA
TRN  10010101100011011
NAM  Q8AW66_BRARE/167-269
ASQ  CVGILHLADVH.SLESLKTQVHSYIVQNFSQVVDHE.EILE.LPADVLVSLIQHDDLGVTEEEQVFDTVIRWVKAREDDRTALLPRVL.THVRL.PLLDPWFFVERVE
DSQ  TGTGTGGGGATCCTGCATCTGGCCGACGTTCAC...TCACTAGAGTCTCTAAAGACACAGGTTCACTCCTACATTGTCCAGAACTTCTCCCAGGTGGTGGATCATGAA...GAGATCCTGGAG...CTTCCCGCAGACGTGTTGGTCAGTCTGATCCAGCATGATGATTTGGGGGTTACAGAGGAAGAGCAGGTGTTTGATACGGTTATCCGCTGGGTGAAGGCCCGAGAGGATGACAGGACAGCTCTGCTGCCTCGCGTACTC...ACACATGTGCGGCTG...CCCTTGCTGGACCCGTGGTTCTTCGTGGAGCGGGTGGAG
TRN  10010101100011001
NAM  KLHL6_MOUSE/163-265
ASQ  CIGILRLADTH.SLDSLKMQVQSCIIQNFVQILNSE.EFLE.LPVDTLYHILRSDDLCVTEEAQVFETVMSWVRHKQSERLCLLPCVL.ENVRL.PLLDPWYFVEMVE
DSQ  TGTATTGGAATACTGAGGCTGGCAGACACACAT...TCTTTGGACAGTTTAAAGATGCAAGTCCAAAGTTGCATCATTCAAAACTTTGTTCAGATTCTGAATTCCGAG...GAGTTCCTTGAA...CTTCCTGTGGACACTTTGTACCACATCTTGAGGAGTGACGACCTGTGTGTGACTGAAGAGGCTCAGGTGTTTGAGACTGTGATGAGCTGGGTCCGGCACAAACAATCAGAACGACTCTGCCTGCTCCCTTGTGTCCTC...GAGAATGTGCGTTTA...CCACTTCTGGATCCGTGGTACTTCGTGGAGATGGTTGAA
TRN  10010101100011000
NAM  Q7SYC4_BRARE/168-270
ASQ  CLGIQRFADAH.SLKQLASRCRSYALQSFADVAQHE.EFLD.LRKEELEEYIASDEMVIGKEETVFEAVMRWVYYDVDHRRIMLKDLL.NHVRL.PLLHPNYFVQTVE
DSQ  TGCTTGGGCATCCAGCGTTTCGCTGACGCTCAC...TCTCTCAAGCAACTGGCCAGCCGTTGCCGCTCTTATGCTCTGCAGAGCTTTGCCGATGTGGCCCAGCACGAA...GAGTTCTTGGAC...TTGCGCAAGGAGGAACTGGAGGAGTACATCGCCAGTGATGAGATGGTGATTGGAAAAGAGGAGACCGTGTTTGAGGCAGTGATGCGTTGGGTGTACTACGATGTGGACCATCGCAGAATCATGCTCAAAGACCTTCTC...AATCATGTCCGCCTG...CCCCTGCTGCATCCAAATTATTTTGTGCAGACGGTAGAA
TRN  10010101100011011
NAM  Q6NRT8_XENLA/167-269
ASQ  CLGIQHFADTH.SLKTLFTKCKSFAQQAFEDVVQHE.EFLE.LGKAELIDYICTDELVVSKEEMVFEAVMRWVYHHVDVRRPMLQELL.THVRL.PLLHPNYFVQTVE
DSQ  TGCCTGGGTATCCAACATTTTGCAGACACTCAC...TCTCTCAAAACCCTCTTCACCAAATGTAAAAGTTTTGCTCAACAGGCCTTTGAAGATGTTGTTCAGCATGAG...GAATTTCTGGAG...CTGGGAAAAGCCGAGCTCATTGATTATATTTGCACTGACGAGCTTGTTGTCAGCAAGGAGGAGATGGTATTTGAAGCCGTCATGCGTTGGGTTTATCATCATGTAGATGTCAGAAGGCCCATGCTTCAAGAACTTCTA...ACCCACGTCCGACTC...CCTTTGCTGCATCCTAACTACTTTGTGCAGACTGTGGAG
TRN  10010101100011011
NAM  Q6PF15_HUMAN/9-111
ASQ  SLALRRVAAAF.SLAPLAERCGRVLRQAFAEVARHA.DFLE.LAPDEVVALLADPALGVAREEAVFEAAMRWVRHDAPARRGQLRRLL.EHVRL.PLLAPAYFLEKVE
DSQ  AGCCTAGCGCTGCGCCGCGTGGCCGCCGCCTTC...TCGCTGGCCCCGCTGGCCGAGCGCTGCGGCCGCGTCCTGCGTCAGGCCTTCGCCGAGGTGGCGCGCCACGCC...GACTTCCTGGAG...CTGGCGCCTGACGAGGTGGTGGCGCTGCTGGCGGACCCCGCGCTGGGCGTGGCGCGCGAGGAGGCCGTGTTTGAAGCGGCCATGCGCTGGGTGCGCCACGACGCGCCGGCCCGCCGCGGCCAGCTGCGACGCCTGCTG...GAGCACGTGCGCCTG...CCGCTACTGGCGCCCGCTTACTTCCTGGAGAAGGTGGAG
TRN  11011111101111111
NAM  Q18670_CAEEL/173-275
ASQ  CVGMAEFARAH.ACHQLAHAAQLYTRQHFVEIIDNE.ELLS.LDKDAFCELIQDDRITVPSEKPVMQAVLNWVAHEEPSRRPFLAELM.SNVRL.PLLGDDYLFEKWR
DSQ  TGCGTCGGAATGGCTGAATTCGCAAGGGCTCAC...GCTTGCCATCAGCTGGCGCATGCTGCTCAGCTGTACACGAGACAGCATTTTGTAGAAATAATCGACAACGAG...GAGCTCCTGAGC...CTTGACAAAGACGCGTTTTGTGAGTTGATACAGGATGACAGAATTACAGTACCCAGTGAGAAGCCTGTAATGCAAGCAGTCTTGAATTGGGTGGCTCATGAAGAGCCCAGTCGACGGCCTTTTTTGGCAGAACTAATG...TCAAATGTTCGCCTG...CCATTGCTGGGTGATGATTATCTTTTCGAAAAATGGAGA
TRN  10010101100011001
NAM  Q8JIM0_BRARE/160-262
ASQ  VIGISRFAEEI.GCTDLHLRTREYINTHFNEVTKEE.EFFS.LSHCQLLELISQDSLKVLCESEVYKACIDWVRWDAESRAQYFHALL.NAVHI.YALPPTFLKRQLQ
DSQ  GTCATCGGCATCTCGAGATTCGCTGAGGAGATC...GGCTGCACTGACCTACACCTTCGCACCAGAGAGTATATCAACACTCACTTCAATGAGGTAACCAAAGAAGAA...GAGTTCTTCAGC...TTGTCCCATTGCCAGCTGCTTGAGCTGATCAGTCAGGACAGTCTGAAGGTGCTCTGCGAGAGCGAGGTCTACAAGGCCTGCATAGACTGGGTACGCTGGGACGCAGAGAGCCGTGCGCAGTACTTCCATGCCCTCCTC...AATGCCGTCCACATC...TACGCCCTTCCACCCACTTTCCTCAAAAGACAACTGCAG
TRN  10010101100011011
NAM  KEAP1_RAT/184-286
ASQ  AIGIANFAEQI.GCTELHQRAREYIYMHFGEVAKQE.EFFN.LSHCQLATLISRDDLNVRCESEVFHACIDWVKYDCPQRRFYVQALL.RAVRC.HALTPRFLQTQLQ
DSQ  GCCATCGGCATCGCCAACTTCGCCGAGCAGATC...GGCTGCACGGAACTGCACCAGCGTGCTCGGGAGTATATCTACATGCACTTCGGGGAGGTGGCCAAGCAGGAG...GAGTTCTTCAAC...CTGTCACACTGCCAGCTGGCCACGCTCATCAGCCGCGATGATCTGAACGTGCGCTGCGAGTCCGAGGTGTTCCATGCGTGCATCGACTGGGTCAAATACGACTGCCCGCAGCGGCGCTTCTACGTGCAGGCACTGCTG...CGGGCCGTGCGCTGC...CACGCTCTCACGCCACGCTTCCTGCAGACACAGCTGCAA
TRN  11011101101011001
NAM  Q7KSF5_DROME/192-294
ASQ  AIGIAHFAEQH.GCVELQKKANVFIERNFTQVCQEE.EFLQ.LSAYQLIALIRRDELNVQEEREVYNAVLKWVKYDEDNRHCKMEHIL.GAVRC.QFLTPNFLKEQMK
DSQ  GCCATTGGCATCGCCCACTTTGCTGAGCAACAC...GGCTGTGTTGAGCTGCAAAAGAAGGCCAATGTGTTTATTGAGCGAAATTTCACTCAGGTGTGCCAAGAGGAG...GAATTCCTGCAG...CTTTCGGCATATCAGTTGATTGCCCTGATACGAAGGGATGAACTGAATGTGCAGGAGGAGCGAGAGGTTTACAACGCTGTGCTAAAGTGGGTGAAATACGACGAGGACAATCGACACTGTAAAATGGAGCACATTTTG...GGCGCTGTCCGTTGT...CAGTTCCTTACGCCCAACTTCCTCAAGGAGCAGATGAAA
TRN  10010101100011011
NAM  Q7QAK9_ANOGA/104-206
ASQ  AIGIANFAEQH.GCESLRQKANQFIERNFTQICREE.EFLQ.LSVMQLICLIRKDELNVQGERDVYDAVLKWVKYDEDNRYPKMESIL.SAVRC.QLLTPSFLKEQMK
DSQ  GCGATCGGCATCGCGAACTTTGCCGAGCAGCAT...GGCTGCGAGTCGCTCCGGCAAAAGGCGAACCAATTCATCGAGCGCAACTTTACCCAGATTTGCCGCGAGGAG...GAGTTCCTACAA...CTGTCTGTGATGCAACTGATATGCCTGATCCGGAAGGACGAGCTGAACGTGCAGGGCGAGCGGGACGTGTACGATGCCGTGCTGAAGTGGGTAAAGTACGACGAGGACAACCGGTACCCGAAGATGGAGAGCATCCTG...TCCGCGGTGCGGTGC...CAGCTGCTGACGCCCAGCTTCCTGAAGGAGCAGATGAAG
TRN  10010111100111011
NAM  Q6DJ21_XENTR/98-200
ASQ  CLGISVLAECL.DCPELKATADDFIHQHFTEVYKTD.EFLQ.LDVKRVTHLLNQDTLTVRAEDQVYDAAVRWLKYDEPNRQPYMVDIL.AKVRF.PLISKNFLSKTVQ
DSQ  TGTTTAGGAATAAGTGTTCTGGCAGAATGTCTC...GACTGCCCAGAGTTAAAGGCCACTGCAGATGATTTTATCCATCAGCATTTCACTGAAGTTTATAAAACAGAT...GAATTTTTGCAG...TTGGATGTGAAACGCGTTACCCATCTACTAAATCAAGACACACTTACTGTCCGTGCAGAGGACCAGGTATATGATGCAGCTGTTCGATGGTTAAAATATGATGAGCCAAACCGACAGCCGTACATGGTGGACATTCTT...GCCAAAGTCCGGTTT...CCTCTTATTTCCAAAAACTTTCTAAGTAAAACTGTTCAA
TRN  10010101100011010
NAM  Q8R2P1_MOUSE/149-251
ASQ  CLGMMVLSDAH.QCRRLYEFSCRMSLVHFETVRQSE.DFNS.LSRDTLLDLISRDELETEDERVVFEAILQWVKHDLEQRKAHLPLLL.RNVRL.ALLPSDCLKNAVS
DSQ  TGCCTTGGCATGATGGTGCTGTCTGATGCCCAC...CAGTGCCGACGGCTCTACGAGTTCTCATGCCGAATGTCCCTGGTGCATTTTGAGACGGTGCGGCAGAGCGAG...GACTTCAACAGT...CTCTCTAGGGACACGCTGTTGGACCTCATCTCCAGAGACGAGCTGGAGACTGAGGATGAGCGCGTGGTCTTTGAGGCCATCCTGCAGTGGGTGAAGCATGACTTAGAGCAGAGGAAGGCCCACCTGCCCCTGCTCCTG...CGTAACGTGCGACTG...GCCCTGCTGCCCTCAGACTGCCTGAAGAATGCCGTATCT
TRN  10010101100011000
NAM  Q6DFF7_XENLA/149-251
ASQ  CLGMMILSDAH.QCQRLYELSLRMCLSNFATLHNTE.DFSS.LSKDMLLDLISSDELEIEDEQVVFNAVLHWVKEDLDKRKDYFPELL.RNVRL.ALLPSELLKEAVV
DSQ  TGTTTGGGAATGATGATTTTGTCTGATGCACAT...CAGTGCCAGAGACTGTACGAGTTGTCTTTGAGAATGTGCTTGTCCAACTTTGCAACTCTGCACAACACAGAA...GACTTCAGCAGT...CTTTCCAAGGATATGTTGCTCGACTTGATCTCCAGCGATGAACTTGAGATTGAGGATGAGCAGGTGGTGTTTAATGCTGTTCTTCACTGGGTAAAGGAGGACTTGGACAAAAGGAAAGATTATTTTCCAGAACTGTTG...AGAAATGTAAGGCTG...GCTTTGCTCCCTTCGGAATTGCTGAAGGAAGCTGTGGTT
TRN  10010101100011011
NAM  Q6TEQ2_BRARE/149-251
ASQ  CLGMMLLSDAH.QCQRLYELSWRMCLANFANLYHTE.DFLS.LPKDKVQELVFSEELEVEDESIVYEAVIDWVRADIGRRHLDLPDLL.RCVRL.ALLPETYLLKTWH
DSQ  TGCCTTGGGATGATGCTTCTGTCTGATGCTCAC...CAGTGCCAGAGGTTGTACGAACTATCCTGGCGAATGTGCCTGGCGAATTTTGCTAATCTCTACCACACTGAG...GACTTCCTAAGC...CTGCCCAAAGATAAAGTTCAGGAACTTGTTTTTAGCGAGGAATTGGAAGTTGAGGATGAAAGTATTGTCTATGAGGCTGTTATTGACTGGGTTAGAGCAGACATTGGGAGGAGACACCTTGACCTTCCTGATCTTTTA...CGTTGCGTTCGCCTT...GCCTTGCTCCCAGAAACATACCTGCTAAAAACGTGGCAT
TRN  10010101100011010
NAM  Q6GNW3_XENLA/149-250
ASQ  CLNMMLISDAH.CCERLLELSWRMCLSNFVELSNTE.DFFR.LPKLKLMELVLSEELEVEDESLVYEAVMGWIKFDLSIRLDDLPDLL.RYVRL.ALLPDQYL-RCLA
DSQ  TGCCTAAACATGATGTTGATATCAGATGCTCAC...TGCTGTGAAAGGTTGCTAGAACTGTCATGGAGAATGTGCCTCTCCAATTTTGTAGAGTTGTCAAACACCGAA...GACTTCTTTAGA...CTTCCCAAACTAAAACTAATGGAACTGGTTCTGAGTGAGGAACTTGAAGTGGAAGATGAAAGTTTAGTCTATGAGGCAGTGATGGGCTGGATTAAGTTTGATTTAAGCATTCGTCTTGATGACCTCCCAGACCTACTG...CGATATGTGCGTTTG...GCACTCCTGCCCGATCAATATCTG---CGATGCCTGGCC
TRN  10010101100011000
NAM  ENC1_HUMAN/149-251
ASQ  CLGMLLLSDAH.QCTKLYELSWRMCLSNFQTIRKNE.DFLQ.LPQDMVVQLLSSEELETEDERLVYESAINWISYDLKKRYCYLPELL.QTVRL.ALLPAIYLMENVA
DSQ  TGCCTGGGCATGCTGCTGCTGTCTGATGCACAC...CAGTGCACCAAGCTGTACGAACTATCTTGGAGAATGTGTCTCAGCAACTTCCAAACCATCAGGAAGAATGAA...GATTTCCTCCAG...CTGCCCCAGGACATGGTAGTGCAACTCTTGTCCAGTGAAGAGCTGGAGACAGAGGATGAAAGGCTTGTGTACGAGTCTGCAATTAACTGGATCAGCTATGACCTGAAGAAGCGCTATTGCTACCTCCCAGAACTGTTG...CAGACAGTAAGGCTG...GCACTTCTGCCAGCCATCTATCTCATGGAGAATGTGGCC
TRN  10010101100011011
NAM  Q8BSF5_MOUSE/136-237
ASQ  CLGLVRLAEIL.SCDSLKKKAKEVALTYFPEVAASA.DLKE.LCAMELRDYLGDDRL-CGEEEKVFEALMAWVKHDLQARWRHMQELL.QQVRL.QYIHPAFFHHFIA
DSQ  TGCCTGGGCCTAGTCAGACTCGCAGAAATCTTA...AGCTGTGACAGCCTTAAGAAGAAAGCGAAGGAGGTGGCCCTGACTTACTTCCCAGAGGTGGCAGCATCAGCT...GACCTGAAGGAG...CTCTGCGCCATGGAGCTGAGGGACTACCTGGGAGATGACAGGCTC---TGTGGTGAGGAGGAAAAGGTGTTCGAGGCCCTCATGGCTTGGGTGAAGCATGACCTTCAAGCCCGGTGGAGGCACATGCAGGAACTGCTG...CAGCAGGTCCGCCTG...CAGTACATCCACCCAGCCTTCTTCCATCACTTCATTGCC
TRN  10010101100011000
NAM  KBTB9_MOUSE/216-318
ASQ  CLGVLAMAEAM.QCSELYHMAKAFALQIFPEVAAQE.EILS.ISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRAQYAAELL.AAVRL.PFIHPSYLLNVVD
NAM  Q6NYM1_BRARE/140-242
ASQ  CLEIQDFAEAY.ACRELAASARRFVLKNIVELAKSM.DFER.LSWKRLLEFVSDDGLCVDKEETAYQIAVRWVKADLQHRLHYWPELL.QQVRL.PFVRRFYLLAHVE
DSQ  TGCTTGGAGATCCAGGACTTTGCTGAGGCTTAC...GCCTGCCGCGAGCTAGCAGCTAGTGCTCGCCGTTTTGTGTTGAAGAACATTGTGGAGCTGGCAAAGAGCATG...GACTTTGAACGG...TTGTCGTGGAAGCGCCTGCTGGAGTTTGTGTCTGATGATGGACTATGTGTGGATAAGGAAGAAACAGCATACCAGATTGCTGTGCGCTGGGTCAAGGCTGACTTGCAACACCGGTTGCATTACTGGCCTGAGTTGTTA...CAGCAGGTACGACTG...CCATTTGTTCGCCGTTTCTATCTTCTGGCTCATGTGGAG
TRN  11011111101111110
NAM  Q5SY28_HUMAN/138-239
ASQ  CLDMQDFAEAF.SCSGLASAAQRFILRHVGELG-AE.QLER.LPLARLLRYLRDDGLCVPKEEAAYQLALRWVRADPPRRAAHWPQLL.EAVRL.PFVRRFYLLAHVE
DSQ  TGCCTGGACATGCAGGACTTCGCTGAGGCCTTC...AGCTGCTCGGGACTGGCGAGCGCGGCGCAGCGGTTCATTCTGCGCCACGTGGGCGAGCTGGGC---GCCGAG...CAGCTGGAGCGG...CTGCCACTGGCGCGCCTGCTGCGCTACCTGCGGGACGACGGGCTGTGTGTGCCCAAGGAGGAGGCCGCCTACCAGCTGGCGCTGCGCTGGGTCCGCGCTGACCCGCCGCGCCGCGCCGCGCACTGGCCGCAGCTGCTG...GAGGCCGTGCGCCTG...CCCTTCGTGCGCCGCTTCTACCTGTTGGCGCACGTCGAG
TRN  11011111101111111
NAM  KLHL8_MOUSE/178-280
ASQ  CLAVRAFAESH.NRIDLMDMADQYACEHFTEVVECE.DFVS.VSPQHLHKLLSSSDLNIDSEKQVYSAAIKWLLANPQHHPKWLDETL.AQVRL.PLLPVDFLMGVVA
DSQ  TGCCTGGCTGTACGAGCCTTCGCAGAGAGTCAC...AACCGAATAGACCTAATGGACATGGCGGACCAGTATGCCTGTGAGCACTTTACTGAAGTGGTGGAGTGCGAA...GACTTCGTGAGT...GTGTCCCCGCAACATCTCCACAAGCTCCTCTCCTCTAGCGACCTCAACATTGACAGTGAGAAGCAGGTCTACAGTGCTGCCATCAAGTGGCTTCTTGCCAATCCGCAACATCATCCTAAATGGCTGGACGAGACACTT...GCACAGGTCCGTCTG...CCATTGCTGCCAGTTGATTTTCTCATGGGTGTTGTGGCG
TRN  10010101100011011
NAM  O18147_CAEEL/153-255
ASQ  ALSIREFCKMMcVEEKITEMTDDYIQKHFMAVSKDE.DFKR.LSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVI-RHEQAAKIL.PCVRL.PLLSPTYLSSIVA
DSQ  GCACTTTCAATTCGAGAATTTTGTAAAATGATGtgcGTCGAGGAGAAGATTACAGAAATGACTGATGACTATATACAGAAACATTTCATGGCAGTATCCAAAGATGAG...GACTTCAAGAGA...CTATCACTAGAAGATGCAATTGAATTGTTAAGAAATGATCATTTATACGTGGATTCTGAAGAACAAGTGTATGTCGCTGCGATGGAATGGTTAAATTGTGATGTGATC---AGACACGAACAGGCAGCGAAAATTCTC...CCATGTGTTCGTCTT...CCACTTCTCAGCCCAACATATCTTTCCTCAATTGTCGCT
TRN  10010101110011000
NAM  Q7SYD2_BRARE/136-238
ASQ  CLAVFRLGLVL.SVPRLAIAARDFIADRFETVSSEE.EFLQ.LAPHELSALIGGDMLNVEKEEVVFESVMKWVRNDKANRVKSLAEAF.DCIRF.RLLPEKYFREKVE
DSQ  TGCCTTGCTGTTTTTAGACTCGGCCTGGTTCTT...AGTGTTCCCAGACTCGCCATAGCGGCTCGTGATTTCATCGCTGACCGCTTTGAGACGGTTTCATCAGAGGAG...GAGTTCCTTCAG...CTGGCTCCTCACGAGCTTTCAGCCCTGATCGGCGGAGACATGCTTAACGTAGAGAAAGAAGAAGTCGTGTTTGAGTCGGTCATGAAATGGGTGCGCAACGACAAGGCCAACCGTGTCAAGAGTCTTGCAGAAGCATTC...GACTGCATCCGCTTC...CGACTTCTCCCAGAGAAGTATTTCAGGGAGAAAGTCGAG
TRN  10010101100011001
NAM  Q6P4N4_XENTR/135-237
ASQ  CLAIFRLGLLL.DCPRLAVTARDYVCDRFMQICNEE.DFLQ.LAPHELIAVISSDGLNVEKEELVFEAVMKWVQTDKENKTKSLSDVF.DCIRF.RLMPEKYFTDKVE
DSQ  TGTTTGGCCATCTTTAGATTGGGCCTTCTATTA...GATTGTCCACGCCTGGCCGTTACTGCCCGAGATTATGTCTGTGATCGATTCATGCAGATCTGCAATGAAGAA...GACTTCCTGCAG...CTTGCGCCACATGAGTTAATCGCAGTCATTTCCAGTGATGGCCTAAATGTGGAGAAGGAAGAGCTGGTGTTTGAGGCCGTGATGAAATGGGTACAAACAGACAAGGAAAACAAAACAAAGAGCCTCTCTGATGTCTTC...GACTGCATTCGATTT...CGCTTGATGCCTGAAAAATATTTTACCGATAAGGTAGAA
TRN  10010101100011010
NAM  KBTBA_HUMAN/135-237
ASQ  CLAILRLGLLL.DCPRLAISAREFVSDRFVQICKEE.DFMQ.LSPQELISVISNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVF.DCIRF.RLMTEKYFKDHVE
DSQ  TGTCTAGCCATCCTAAGATTAGGACTTCTTCTT...GACTGCCCGAGACTCGCCATTTCTGCCCGTGAATTTGTGTCTGATCGCTTTGTACAGATTTGTAAGGAAGAG...GACTTTATGCAA...CTGTCTCCACAGGAACTGATCTCAGTCATTTCAAATGACAGCCTAAATGTAGAAAAAGAAGAAGCAGTATTTGAGGCAGTGATGAAATGGGTGCGAACAGACAAGGAAAACAGGGTTAAAAACCTTAGTGAAGTGTTT...GATTGTATCCGTTTT...CGCCTTATGACAGAAAAATATTTTAAGGATCATGTTGAG
TRN  10010101100011000
NAM  Q6ZUS1_HUMAN/117-219
ASQ  CLGICEFGEQQ.GLLGVAAKAWAFLRENFEAVARED.EFLQ.LPRERLVTCLAGDLLQVQPEQGRLEALMRWVRHDPQARAVHLPELL.SLVHL.DAVPRPCVQQLLA
DSQ  TGCCTGGGCATCTGTGAGTTCGGGGAGCAGCAA...GGGCTGCTGGGCGTGGCTGCCAAGGCCTGGGCCTTCCTGCGAGAGAACTTTGAGGCTGTGGCACGTGAGGAC...GAGTTCCTGCAG...CTTCCCCGAGAGCGGCTGGTCACTTGTCTGGCCGGCGACCTGCTGCAGGTACAGCCGGAGCAAGGCCGACTCGAGGCCCTGATGCGCTGGGTGCGCCATGACCCGCAGGCCCGGGCCGTCCACCTGCCCGAGCTGCTC...AGCCTAGTGCACCTG...GACGCCGTGCCCAGGCCCTGCGTGCAGCAACTGCTGGCC
TRN  10010101100011011
NAM  Q6INL2_XENLA/135-237
ASQ  CLGIWEFGETH.GCPEVAAKALSFLQENFEAVSQEE.EFLL.LSPERMLCYLGDPLLQVRDEQSRAKAALHWVKQDKECRAQCLPQLL.SVAQL.SSLTDQYLQELME
DSQ  TGCTTGGGTATCTGGGAATTTGGTGAAACACAT...GGCTGCCCTGAAGTAGCAGCAAAAGCATTGTCCTTCCTACAGGAGAACTTTGAAGCAGTTTCTCAGGAAGAG...GAGTTCTTGCTT...TTGAGCCCTGAGAGGATGCTGTGTTATTTGGGAGACCCACTGCTACAGGTCAGGGATGAGCAGAGCCGAGCTAAGGCAGCTCTACATTGGGTAAAGCAAGACAAGGAATGTAGGGCCCAATGTCTTCCACAGTTGCTG...AGTGTGGCCCAGCTA...TCCAGCTTGACTGACCAATATCTGCAGGAGTTGATGGAG
TRN  10010101100011011
NAM  Q9D618_MOUSE/131-233
ASQ  CIGIYYFAKQI.GAEDLSDQSKKYLYQHFAEVSLHG.EILD.IEAHQLLALIKSDDLNISREESILDLVLRWVNHNQALRTEHLVELL.KQVRL.ELINASFLRQALR
DSQ  TGCATAGGAATTTATTACTTTGCAAAACAAATC...GGAGCAGAAGATTTATCGGATCAGTCGAAGAAGTATTTATACCAGCACTTCGCCGAGGTAAGCCTTCATGGA...GAAATACTTGAC...ATCGAAGCTCACCAGCTTCTGGCACTTATTAAGTCTGATGATCTGAATATATCCAGAGAAGAGAGCATTCTGGATTTGGTTCTGAGATGGGTAAACCATAACCAAGCTTTGCGCACAGAGCATCTCGTTGAGCTTTTG...AAGCAAGTCAGACTG...GAACTTATAAACGCTTCCTTTCTAAGACAGGCCCTCAGA
TRN  10010101100011010
NAM  Q8NFY9_HUMAN/126-229
ASQ  SIGVFIFADHY.GHQELGDRSKEYIRKKFLCVTKEQ.EFLQ.LTKDQLISILDSDDLNVDREEHVYESIIRWFEHEQNEREVHLPEIFaKCIRF.PLMEDTFIEKIPP
DSQ  TCTATTGGGGTCTTTATCTTTGCTGATCATTAT...GGTCATCAGGAACTCGGAGATCGATCAAAAGAATACATTCGTAAAAAGTTTCTGTGTGTCACCAAAGAACAA...GAGTTTCTCCAG...TTGACAAAAGACCAACTGATAAGTATACTAGACAGTGACGATTTAAATGTAGACCGAGAAGAGCATGTTTATGAAAGCATTATAAGGTGGTTTGAGCATGAACAGAATGAAAGAGAAGTGCACCTTCCAGAAATTTTTgctAAATGCATACGTTTT...CCTCTGATGGAAGATACCTTTATAGAGAAAATTCCACCT
TRN  10010101100011000
NAM  Q6N066_HUMAN/154-256
ASQ  CLQLLSISDSY.GSTSLFDHALHFVQHHFSLLFKSS.DFLE.MNFGVLQKCLESDELNVPEEEMVLKVVLSWTKHNLESRQKYLPHLI.EKVRL.HQLSEETLQDCLF
DSQ  TGTTTACAGTTATTATCTATATCAGATAGCTAT...GGCTCCACCAGTTTGTTTGATCATGCATTACACTTTGTACAACATCACTTTTCTTTATTATTTAAATCCAGT...GATTTCTTAGAG...ATGAATTTTGGAGTACTACAGAAATGTCTGGAATCAGATGAATTAAATGTTCCTGAAGAAGAAATGGTACTGAAAGTTGTCCTTAGTTGGACTAAACATAACTTAGAATCAAGGCAAAAGTATCTGCCTCATTTGATT...GAAAAAGTGAGATTA...CATCAGTTATCTGAGGAGACACTTCAGGACTGTCTGTTC
TRN  10010101100011000
NAM  Q6IR89_XENLA/133-234
ASQ  CVRLLSFADLF.SCEELKQSAKRMVEHKFTTVYHQE.AFMQ.LSSELLIELVSSDNLNVEKEETVREAAMSWLDYNTVSRSQYLSTVL.SHLRI.DALS-EVIQREWF
DSQ  TGTGTGCGGCTGCTAAGTTTTGCCGATCTGTTT...AGCTGTGAAGAACTAAAACAAAGCGCCAAAAGAATGGTAGAGCACAAATTCACAACTGTGTATCACCAGGAA...GCTTTTATGCAA...CTGTCCAGTGAGCTCTTGATAGAACTTGTTAGCAGTGACAATCTGAATGTGGAAAAAGAAGAGACAGTCCGAGAAGCTGCAATGTCTTGGCTTGACTACAACACTGTGTCCCGCTCACAGTACTTGTCTACTGTTCTG...AGCCATCTCCGTATA...GATGCATTATCA---GAAGTGATACAGAGGGAGTGGTTT
TRN  10010101100011000
NAM  Q8CA72_MOUSE/133-235
ASQ  CIGIRDFALHY.CLHHVHYLATEYLETHFRDVSSTE.EFLE.LSPQKLKEVISLEKLNVGNERYVFEAVIRWIAHDVEMRKVHMKDVM.SALWV.SGLDSSYLREQML
DSQ  TGCATTGGCATCCGGGACTTTGCGCTGCACTAC...TGCCTGCACCACGTGCATTACCTGGCCACTGAGTACCTGGAGACCCACTTCCGAGACGTCAGCAGCACAGAG...GAGTTCCTGGAG...CTGAGTCCACAGAAACTCAAAGAAGTGATCTCTCTCGAGAAGCTGAACGTTGGCAACGAGAGATACGTGTTCGAGGCAGTGATTCGGTGGATAGCACACGATGTAGAGATGAGAAAGGTCCACATGAAGGATGTCATG...TCAGCGCTGTGGGTC...TCGGGGCTGGACTCCAGCTACCTGCGCGAGCAGATGCTG
TRN  10010101100011001
NAM  Q6GQU2_MOUSE/139-240
ASQ  CIGMHSFAEFH.VCSELEKESRRILCSRFKEVWQQE.EFLE.ISLEKFLFILSRKNLSVWKEEAILEPVIKWTAHDVENRIECIYNLL.SYINI.D-IDPVYLKTALG
DSQ  TGTATCGGGATGCACTCTTTTGCAGAATTCCAT...GTGTGCTCAGAACTAGAGAAGGAATCCCGCAGGATCCTCTGCTCCAGGTTTAAGGAAGTTTGGCAGCAAGAA...GAATTTCTGGAA...ATCAGCCTTGAAAAGTTTCTCTTTATCTTGTCCAGAAAGAATCTGAGTGTCTGGAAGGAAGAGGCTATCTTAGAGCCGGTCATTAAGTGGACTGCTCACGATGTAGAGAATCGAATCGAATGCATCTACAACCTGCTA...AGCTATATCAACATA...GAC---ATAGACCCAGTGTACTTAAAGACGGCTCTAGGC
TRN  10010101100011000
NAM  Q7ZVF7_BRARE/174-276
ASQ  CVAIHSLAHMY.TLDQLALRAVDMIRRNFHKVIQDE.EFYT.LPFRLVRDWLSDAEITVDSEEVLFDAVVKWVQKNSEERVKYFEELF.RLLRL.PQIKPTYLTRVVK
NAM  Q6GKZ1_DROME/195-298
ASQ  CVSIMGFARFR.FLEDLHLKARNYTLRYFTEVAYRNiDILD.MSAEDFYSIISDDELNTREEDHVWKLCVKWIDRNPESRKRHVAHLM.TGVRL.GLMTPKCFMEEVK
DSQ  TGTGTCAGTATTATGGGATTCGCACGGTTCCGA...TTTTTGGAGGACCTTCACCTGAAGGCCAGGAACTACACTCTAAGGTACTTTACTGAAGTTGCATATCGTAATattGACATACTAGAT...ATGTCAGCTGAAGACTTTTACAGTATTATTAGCGATGATGAGTTAAATACCCGCGAAGAGGATCACGTATGGAAATTGTGTGTTAAATGGATCGACCGTAATCCAGAAAGCCGCAAGCGCCATGTTGCCCATCTAATG...ACTGGGGTACGACTG...GGCCTAATGACTCCAAAGTGCTTCATGGAAGAGGTTAAG
TRN  10010101100011000
NAM  P87597_COWPX/101-204
ASQ  CLDIITYAAFY.NLEDLKIAAINTTATNFTHVVKDD.TFLS.LPFDIISSIFENDDLNTKSEDEAMDALCIWMKDDAE-RINMVKENIsKLIRVdELLSKKYILNELG
DSQ  TGTCTAGATATCATAACTTATGCAGCATTTTAT...AATTTGGAGGATCTAAAAATAGCTGCTATTAATACAACAGCAACTAATTTTACACATGTAGTTAAAGATGAT...ACGTTTCTATCT...TTGCCATTTGATATTATCAGTTCCATATTTGAAAACGACGACCTCAACACAAAATCAGAAGATGAAGCCATGGATGCACTATGTATATGGATGAAAGATGATGCTGAA---CGTATCAACATGGTCAAGGAAAATATTagtAAACTAATTAGAGTAgatGAGCTATTATCTAAGAAGTATATTCTGAACGAACTAGGA
TRN  10010101100011000
NAM  Q8N4N3_HUMAN/148-250
ASQ  YLYLQELASIY.SLKRLDAFIDGFILNHFGTLSFTP.DFLQnVSMQKLCVYLSSSEVQRECEHDLLQAALQWLTQQPE-REAHARQVL.ENIHF.PLIPKNDLLHRVK
DSQ  TACCTGTACCTGCAGGAGCTGGCCTCCATCTAC...AGCCTCAAGCGGCTTGATGCCTTCATCGATGGCTTCATCCTGAACCACTTCGGCACGCTGTCCTTTACGCCC...GACTTCCTGCAGaacGTCTCCATGCAGAAGCTGTGTGTCTACCTGAGCAGCAGCGAGGTGCAGCGGGAGTGTGAGCACGACCTCTTGCAGGCCGCCCTGCAGTGGCTGACGCAGCAGCCCGAG---CGCGAGGCCCACGCCCGCCAGGTGCTG...GAGAACATCCACTTC...CCGCTCATCCCCAAGAACGACCTGCTGCACCGCGTCAAG
TRN  11011111101111111
NAM  Q6KAS2_MOUSE/175-277
ASQ  YLYLQELASIY.SLKRLDAFIDSFVLSHFSTLSFTP.DFLQsISVQKLCVYLSSGQVQHKWEYDLLQVALQWLTQQPE-REVHTRRVL.ENIRF.PLFPEDILLQRVK
DSQ  TATCTCTACCTACAGGAGCTGGCCTCCATCTAC...AGTCTCAAGAGGCTCGATGCCTTCATCGATAGCTTCGTACTGAGCCACTTCAGCACGCTGTCCTTCACGCCT...GACTTCCTGCAGtccATCTCCGTGCAGAAGCTGTGTGTCTACCTGAGCAGTGGCCAGGTACAGCACAAATGGGAATACGACCTGCTGCAGGTGGCTCTGCAGTGGCTCACGCAGCAGCCGGAG---CGCGAGGTGCACACCCGCCGCGTTCTG...GAGAACATCCGCTTC...CCCCTCTTCCCCGAGGACATCCTGCTACAGCGGGTGAAG
TRN  10010101100011011
NAM  Q8BWA5_MOUSE/172-273
ASQ  CMYVVNIAETY.SLKNAKATAQKFIRDNFIEFAESE.QFMK.LTFEQINELLVDDDLQLPSELVAFQIAMKWLEFDQK-RVKHAADLL.SNIRF.GTISAQDLVNYVQ
DSQ  TGCATGTACGTGGTTAACATTGCTGAGACCTAC...AGCTTGAAAAACGCAAAGGCAACAGCCCAGAAATTCATCCGGGATAACTTCATCGAATTTGCAGAATCCGAA...CAATTTATGAAG...CTTACGTTTGAACAGATTAACGAGCTTCTCGTAGATGACGACTTACAATTGCCTTCTGAGCTTGTAGCATTCCAGATCGCAATGAAATGGTTAGAATTCGACCAAAAG---AGAGTGAAGCATGCGGCAGATCTTCTA...AGCAACATTCGCTTT...GGTACCATCTCTGCACAAGACCTGGTCAATTATGTTCAA
TRN  10010101100011010
NAM  Q6Q7X9_BRARE/173-274
ASQ  CMYVVNIADTY.NLKETKEAAQKFMRENFIEFSEME.QFLK.LTYEQINEFLTDDSLQLPSELTAFQIAVKWLDFDEK-RLKYAPDLL.SNIRF.GTITPQDLVSHVQ
DSQ  TGCATGTATGTGGTCAACATTGCCGACACGTAC...AATCTAAAAGAGACGAAGGAAGCTGCTCAGAAGTTCATGCGAGAGAACTTCATTGAGTTCTCCGAGATGGAG...CAGTTCCTCAAA...CTCACCTACGAGCAAATCAACGAGTTCCTCACAGACGACTCACTTCAGTTGCCTTCAGAGCTCACGGCTTTCCAGATCGCAGTCAAGTGGTTGGATTTTGATGAAAAG---AGGTTGAAGTACGCTCCTGATCTGCTG...TCCAACATCCGTTTT...GGCACCATCACCCCCCAGGATCTTGTTAGTCACGTGCAG
TRN  10010101100011001
NAM  Q8BGY4_MOUSE/156-257
ASQ  CLHIGQMATTF.SLTSLRESVDAFTFRHFLQIAAEE.DFLR.LPLERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDPA-RRARASLVL.RHVRF.PLMQPAELVDSVQ
DSQ  TGCCTGCACATTGGCCAGATGGCTACCACCTTC...AGCCTGACATCACTGCGTGAGTCAGTAGATGCCTTCACATTCCGCCACTTCCTGCAGATAGCAGCAGAAGAG...GACTTTCTGCGC...CTGCCACTCGAGCGCCTTGTCTTCTTTCTGCAGAGCAACCGGCTGCAGAGCTGCGCCGAGATTGACCTGTTCCGCGCTGCTGTGCGCTGGCTGCAGCATGATCCTGCC---CGCCGCGCCCGTGCCAGCCTTGTGCTA...CGCCACGTGCGCTTC...CCGCTCATGCAACCTGCTGAACTGGTGGACAGCGTGCAG
TRN  10010111100111001
NAM  Q6DE07_XENLA/176-277
ASQ  CVEVGRIANTY.NLTEVDKYVNNFILKNFPALLTTG.EFVK.LPFDRLAFVLSSNSLKQCTELELFKAACRWLRYEDT-RMDYAAKIM.KNIRF.PLMTPQDLINHVQ
DSQ  TGCGTTGAGGTTGGTCGAATAGCAAACACATAC...AATCTTACGGAGGTTGATAAATATGTAAATAACTTTATCTTGAAGAATTTTCCAGCATTATTAACAACGGGG...GAGTTTGTGAAA...CTCCCATTTGATCGTCTTGCTTTTGTGCTTTCCAGTAATAGCCTTAAGCAGTGCACTGAACTGGAACTCTTCAAGGCTGCCTGTCGTTGGCTACGGTATGAGGACACT---CGAATGGATTATGCTGCAAAAATAATG...AAGAACATTCGGTTC...CCACTAATGACACCACAAGACCTTATAAACCATGTCCAG
TRN  10010101100011010
NAM  Q9W2S3_DROME/150-248
ASQ  VCMILDAARLY.NLEELTEVCLMFMDRNAGDLLLHN.SFNT.LSKESLEEVLRRDCF-FAPEVQIFLAVWKWSRFNSN---VDFKSVV.SYVRL.PLMNLEHLLQVVR
DSQ  GTCTGCATGATTCTTGATGCGGCGCGTCTATAC...AATCTAGAGGAACTCACCGAGGTTTGCCTAATGTTCATGGATCGCAATGCCGGCGACCTGCTGCTGCACAAC...AGCTTCAATACG...CTATCCAAGGAATCGCTGGAGGAGGTACTACGGCGTGACTGCTTC---TTCGCCCCCGAGGTGCAGATCTTTTTGGCCGTGTGGAAGTGGAGCCGCTTCAATAGCAAC---------GTGGACTTCAAGTCCGTGGTT...AGTTATGTCCGCCTG...CCACTGATGAACCTCGAGCATCTGCTGCAGGTGGTGCGT
TRN  11011111101111111
NAM  Q7QI84_ANOGA/148-248
ASQ  VCAILDAARLF.ALDGLTAVCHSFMDRNAADILQHE.SFRH.LSLDSLCSLLLRDSF-FAREVEIFQAVFDWCRCNAD-TVPNVDVVV.GKVRF.ELMSLEELLTVVR
DSQ  GTGTGCGCAATTCTGGACGCGGCCCGGCTGTTC...GCGCTCGACGGGCTCACCGCCGTCTGCCATTCGTTCATGGACCGGAACGCGGCGGACATACTGCAGCACGAA...TCGTTCCGCCAT...CTGTCGCTCGATTCGCTGTGTAGCCTGCTGCTGCGGGACTCGTTC---TTTGCGCGCGAGGTCGAAATTTTCCAAGCCGTCTTCGATTGGTGCCGGTGCAACGCGGAC---ACCGTGCCGAACGTGGACGTCGTCGTG...GGCAAGGTGCGGTTC...GAGCTGATGTCGCTCGAGGAGCTGCTGACGGTGGTACGG
TRN  10010111100111011
NAM  Q7QIC9_ANOGA/141-242
ASQ  VCAILDAGRLF.DLADLLAVCDEFVDRNALAVLRHE.TFQN.LTFESLCRLLDRDKF-DAPEVDIFLAVHKWYRAKEDADADQYKKIY.DKVRF.PLMSHNELVTVVR
DSQ  GTGTGCGCTATTTTGGACGCCGGTCGGCTGTTC...GATCTCGCCGACCTGCTTGCGGTGTGTGACGAGTTTGTCGACAGGAATGCACTCGCTGTGCTGCGGCATGAG...ACGTTCCAGAAT...CTCACATTCGAGTCGCTGTGCAGATTGCTCGATCGGGATAAGTTT---GATGCACCGGAGGTAGATATATTTCTCGCCGTGCATAAGTGGTACCGAGCGAAGGAAGATGCGGATGCGGATCAGTACAAGAAAATATAC...GACAAGGTGCGCTTT...CCGCTGATGTCCCACAACGAGCTGGTCACGGTGGTGCGA
TRN  10010101100011011
NAM  Q8C2V5_MOUSE/142-240
ASQ  VCMTFDVASLY.SLPKLTCMCCMFMDRNAQEVLASD.GFLS.LSKTALLNIVLRDSF-AAPEKDIFLALLNWCKHN---AKENHAEIM.QAVRL.PLMSLTELLNVVR
DSQ  GTCTGTATGACCTTTGATGTTGCCAGTCTCTAC...TCGCTTCCCAAGTTAACTTGTATGTGCTGCATGTTCATGGACAGAAATGCTCAGGAGGTGCTGGCCAGCGAC...GGCTTCCTCTCC...CTGTCCAAGACAGCACTCCTGAATATCGTCTTAAGAGATTCGTTT---GCTGCTCCTGAGAAAGATATTTTCTTAGCCTTGTTAAACTGGTGTAAGCACAAT---------GCAAAAGAGAATCATGCTGAAATCATG...CAGGCTGTGCGCTTA...CCTCTAATGAGCCTCACTGAGCTTCTGAACGTCGTGAGG
TRN  10010101100011010
NAM  Q6GML3_BRARE/142-241
ASQ  VCLVFDVASLY.CLNGLAEACMAYMDRNAVEVLKSD.GFLT.LSKSALLTVVRRDSF-ASSEREIFQALCHWCHHNG--DGPEAKEVM.SAVRL.PLMTLSEMLNVVR
DSQ  GTCTGTTTGGTGTTCGATGTGGCCAGTCTCTAC...TGTCTGAATGGTTTGGCGGAGGCCTGCATGGCTTACATGGACCGTAACGCCGTTGAAGTGTTAAAGTCAGAC...GGCTTTCTGACT...CTTTCAAAGTCTGCCCTGTTGACAGTTGTGAGGAGAGATTCGTTC---GCTTCGAGTGAGAGGGAGATCTTTCAGGCTCTATGCCACTGGTGTCACCACAATGGA------GATGGCCCAGAGGCAAAGGAAGTGATG...TCAGCCGTCCGACTT...CCTCTGATGACCCTCTCTGAAATGCTAAATGTGGTTCGT
TRN  10010101100011000
NAM  O16313_CAEEL/170-270
ASQ  LCSIFNAAYFF.QFTDLIDYCMQYSDKHADQLLEDP.SFNR.LSGDSLKELLARDSF-FALELKIFNAVRSWHQNNPT-MKEASKVLL.ELVRL.PLITQTELLNCVR
DSQ  TTGTGTAGTATTTTCAATGCTGCATACTTCTTT...CAATTCACTGATCTTATAGATTATTGCATGCAATATTCTGATAAACATGCAGATCAGCTTCTCGAAGATCCC...AGCTTCAACCGA...TTATCAGGAGATAGTCTGAAGGAGCTTCTTGCGAGAGATTCATTT---TTTGCATTAGAATTGAAGATCTTCAATGCGGTACGTTCATGGCATCAGAATAATCCAACA---ATGAAAGAAGCATCAAAAGTTTTGCTG...GAATTGGTCAGACTT...CCCCTTATAACACAAACCGAACTTCTTAATTGTGTAAGA
TRN  10010101100011000
NAM  Q9W4S3_DROME/306-407
ASQ  AFQAYIMAKDY.RCPEIMIVMQSRLRKCFLPIVASW.EFLE.FDVNEVTTLLEQDMLCVNSEDEIFFAVFHWLNYSWTERKKHAVKVM.QKVRF.GLLSP-WLRRSIC
DSQ  GCCTTTCAAGCCTACATCATGGCCAAGGATTAT...CGCTGCCCGGAGATTATGATTGTAATGCAATCGCGTTTGCGAAAATGCTTTCTACCAATTGTGGCATCTTGG...GAGTTTCTCGAA...TTCGATGTGAATGAAGTGACCACTTTGCTGGAACAAGACATGCTGTGTGTTAATAGTGAGGATGAGATTTTCTTCGCCGTCTTTCACTGGTTGAATTACTCCTGGACGGAACGCAAGAAGCACGCGGTCAAGGTGATG...CAAAAAGTACGTTTT...GGACTCCTGTCACCC---TGGTTGCGTCGATCCATTTGT
TRN  11011101101011001
NAM  Q9V755_DROME/214-317
ASQ  ACVLYVESKDNpAMDVVRNLMLTRIRKFLLTFVATR.DFLD.LPTSHLIFLLESDQICVNTEIEVFFIAVRWLGHDWNKRKVHVRRLM.SCIRF.NLMPLWYLLYARR
DSQ  GCATGTGTCCTATACGTCGAGTCGAAGGACAATcccGCCATGGATGTAGTTCGCAATTTGATGCTGACTAGGATCCGCAAGTTTCTGCTCACCTTTGTGGCCACCAGG...GATTTCCTCGAT...CTGCCGACCTCCCATCTGATTTTTTTGCTCGAATCCGATCAAATCTGTGTGAACACCGAGATTGAGGTTTTCTTTATAGCTGTTCGATGGCTGGGTCACGATTGGAACAAGAGGAAAGTGCACGTACGTCGTTTAATG...TCCTGTATTCGATTC...AACCTGATGCCATTGTGGTATCTACTATATGCGCGACGG
TRN  10010101100011010
NAM  Q8IH95_DROME/224-325
ASQ  AAMLYFEAKIL.KLEVIHLQYLERVSKFFLTLVASK.EFLR.LPLKSMLLLIQSDLIGVNTELEVFMAAARWLSHHWPQREENVTDVV.SSIRF.GLIPPWLLIR-LQ
DSQ  GCTGCGATGCTGTACTTTGAGGCGAAAATACTG...AAACTTGAGGTCATCCATTTGCAATATCTTGAGCGCGTCTCAAAGTTTTTTCTCACGCTGGTGGCATCGAAA...GAGTTTTTGAGA...CTGCCGCTGAAATCAATGCTATTGCTCATCCAATCGGATCTGATAGGCGTGAATACGGAGCTGGAGGTCTTCATGGCAGCCGCTCGGTGGCTAAGCCACCACTGGCCTCAAAGAGAGGAAAACGTAACGGATGTTGTA...TCCAGCATACGTTTT...GGACTAATCCCGCCGTGGTTGCTCATCCGT---TTACAG
TRN  10010101100011000
NAM  Q9W4L5_DROME/162-265
ASQ  AFQVYLRALKYpQLEELRKLMLQRIGAAFLAVLGGD.DFQR.MPLEDVITMLQQDSLGVNSEMEVLVAIIRWLNCQSKCIDQATPLLM.DCLRL.TLLPLPILKRFWR
DSQ  GCCTTTCAGGTTTACTTGAGGGCTTTGAAATATccgCAACTCGAGGAGCTGCGCAAACTGATGCTGCAAAGGATCGGTGCTGCTTTTCTGGCCGTGCTGGGTGGTGAT...GATTTTCAGCGA...ATGCCTCTCGAGGATGTGATTACCATGCTGCAGCAGGACTCATTGGGTGTCAATTCGGAAATGGAGGTGCTTGTGGCCATTATAAGATGGCTGAATTGTCAATCGAAATGCATTGACCAGGCGACGCCACTATTGATG...GACTGCCTTCGGCTG...ACACTCTTACCACTGCCAATTTTGAAAAGATTTTGGCGC
TRN  10010101100011000
NAM  Q9Q8G2_9POXV/125-224
ASQ  CLHYYEFSKRY.NRRHIFNVVITTIIHNIVSVLRQP.NFKT.IELCDLQNILSSDDLNVIDEDVCAVVLVTWLKQN--NMEDCPSVLL.EQVRM.SLLSMS-VKNLLL
DSQ  TGCCTCCATTACTACGAATTTTCCAAACGTTAC...AACAGACGACATATATTCAACGTGGTAATCACGACGATTATACACAACATCGTCAGTGTGTTAAGACAACCC...AATTTTAAGACC...ATCGAGTTATGCGATCTGCAGAATATATTATCCAGCGACGATTTAAACGTGATAGACGAGGATGTATGCGCCGTCGTCTTAGTCACCTGGTTGAAGCAAAAC------AACATGGAAGATTGCCCATCCGTTTTACTG...GAACAAGTACGGATG...TCGTTACTCTCAATGTCT---GTGAAAAACCTTCTACTA
TRN  10010101100011000
NAM  Q8V3G0_SWPV/125-224
ASQ  CLQVYMFSKVH.NLFRLMDVALSTIIMNITTIYKHD.NFGL.LDEKDIELILGSDYLNIIDEDISVVILFNWLRYN--NVTRCPLSIL.AKIRL.SLLSNQ-VSKFIH
DSQ  TGTTTACAAGTTTATATGTTTTCTAAAGTACAC...AATCTATTTAGATTAATGGATGTGGCATTATCTACAATTATAATGAATATAACAACTATATATAAACATGAT...AATTTTGGTTTA...TTAGATGAAAAAGATATAGAATTAATTTTAGGAAGCGACTATCTTAATATTATCGATGAAGATATATCAGTTGTTATATTATTTAATTGGTTACGCTATAAT------AATGTTACTCGGTGTCCATTATCGATATTA...GCTAAGATACGCTTA...TCATTATTATCTAATCAG---GTTAGTAAATTTATTCAC
TRN  10010101110011000
NAM  Q9DHH3_YLDV/126-228
ASQ  CLRMYYYAKKF.CRKELENVAMEMIIKNILKIVSRP.EFNS.ICISDLKIILSNEKLNVIDEDLAAYILSKWLNKNKNTVKKCPLSLL.KTIKK.SLLCEKMIELLLN
DSQ  TGTTTACGAATGTACTATTATGCTAAAAAATTT...TGTAGAAAGGAACTTGAAAATGTAGCAATGGAAATGATAATTAAAAATATTTTAAAAATTGTATCCCGCCCA...GAATTCAATAGT...ATTTGTATTTCTGATTTAAAAATAATTTTATCTAACGAAAAATTAAACGTTATAGATGAAGATTTAGCTGCATATATACTAAGTAAATGGTTAAATAAAAACAAAAATACAGTTAAAAAATGTCCACTCTCGCTATTA...AAAACAATTAAAAAA...TCGTTACTATGTGAAAAAATGATTGAGTTGTTACTTAAC
TRN  10010101110011010
NAM  O72736_COWPX/123-222
ASQ  CIDFYIYADKY.NNKKIESASFNTILRNILRLINDE.NFKY.LTEESMIKILSDDMLNIKNEDFAPLILIKWLEST---QQSCTVELL.RCLRI.SLLSPQVIKSLYS
DSQ  TGTATCGATTTCTACATATATGCTGATAAATAT...AATAACAAGAAAATAGAATCAGCGTCGTTTAACACAATATTACGAAATATTTTGAGACTCATCAACGATGAA...AACTTTAAATAC...TTAACAGAGGAATCAATGATAAAAATTTTAAGCGATGATATGTTAAATATAAAAAATGAGGATTTTGCACCACTAATTCTCATTAAATGGTTAGAGAGTACT---------CAACAATCATGCACCGTCGAGTTACTT...AGATGCCTCAGAATA...TCATTACTTTCCCCACAAGTTATAAAATCACTTTATAGT
TRN  10010101110011000
NAM  Q8JTN6_LSDV/122-221
ASQ  CLDACIFSEFY.NLKKLNKFTYKFIRKNIRKIYLKK.DFIY.LSFNVIDLLLRDKKTVFYNEDDVLCIILQWLNNEA--NNKYFHDVL.KVIRF.SLLSEECADK-LK
DSQ  TGTCTCGATGCATGTATTTTTTCAGAATTTTAT...AACTTAAAAAAACTAAATAAGTTTACTTATAAATTTATACGGAAAAATATACGCAAAATATATTTAAAAAAA...GATTTTATTTAT...TTATCATTTAACGTTATTGATCTTCTTTTACGAGATAAAAAAACTGTATTCTATAATGAAGATGATGTATTATGTATCATATTACAATGGCTTAATAATGAGGCA------AATAATAAATATTTTCATGATGTTTTA...AAAGTAATAAGATTT...TCACTTTTGTCAGAAGAATGTGCCGACAAG---CTTAAG
TRN  10010101110011000
NAM  Q8JTM8_LSDV/120-221
ASQ  CIEIYKFSQYY.GYKKLSSYTYDYIRCYIESIYNQN.EFTT.LTINDIMKLLSDRKTIVASENSVVEILVSWLTSQNSISCFEICKIL.KLIKI.PFVTEEYFKK-LQ
DSQ  TGTATAGAGATATACAAATTTTCACAATATTAT...GGTTATAAAAAATTGTCATCATATACTTATGATTATATAAGATGTTATATAGAATCAATATATAATCAAAAT...GAATTTACAACA...TTAACTATTAATGATATTATGAAATTACTATCTGATAGGAAAACTATCGTTGCATCGGAAAATAGTGTTGTTGAAATACTAGTTAGTTGGTTAACTTCACAAAATAGTATAAGTTGTTTTGAAATTTGTAAAATACTC...AAACTTATTAAAATA...CCATTTGTTACAGAAGAATATTTTAAAAAA---CTACAA
TRN  10010101110011000
NAM  O72746_COWPX/102-200
ASQ  CLEIYRITNIN.ALSYIYNDVRNFILDNILLIYKDP.DFIY.LPKYIIIDLLSDDHLNVFNEDNVIKIIYTYISSD---IYKDISDIL.PVIRW.NYLSPEWLTD-ME
DSQ  TGTTTAGAAATTTATAGAATAACTAATATTAAT...GCATTATCGTATATCTACAACGATGTAAGAAACTTCATATTGGATAATATACTATTAATATATAAGGATCCA...GATTTTATATAT...TTGCCTAAATACATTATTATAGATTTACTATCGGACGATCACCTAAATGTTTTTAACGAAGATAATGTGATAAAGATTATATACACTTATATATCTTCCGAT---------ATCTACAAGGATATTTCAGATATACTA...CCGGTTATCAGATGG...AATTATCTCTCACCCGAATGGTTAACAGAT---ATGGAA
TRN  10010101110011000
NAM  Q8JU17_LSDV/121-220
ASQ  CVDIFRRSYMY.GCYDVYDVADKYIKKRFMYIS--N.DLTK.LRVNELRPILKSSDLVVDTEDFVLNFIIKWGTVKKTNRLNTMKLVN.DSVRF.TFLTEKG-KKRLR
DSQ  TGTGTTGATATCTTTAGAAGATCTTATATGTAT...GGTTGTTACGATGTGTACGATGTTGCAGATAAATATATTAAAAAAAGGTTTATGTATATAAGC------AAC...GATTTAACTAAA...TTAAGAGTTAATGAATTAAGGCCCATATTAAAAAGTAGTGATTTAGTTGTCGATACCGAAGATTTTGTTCTTAATTTTATAATTAAGTGGGGAACTGTAAAAAAAACTAATAGGCTTAATACGATGAAGTTAGTAAAT...GACTCTGTAAGATTT...ACCTTTTTAACAGAAAAAGGA---AAAAAAAGGTTACGA
TRN  10010101110011010
NAM  Q9DB72_MOUSE/169-269
ASQ  AVGWYHYAVST.GDEALRESCLQFLAWNLSAVAGSA.EWGA.VSPELLAQLLQRSDLVLQDELELFHALEAWLGRARP-PPTVAERAL.RAIRY.PMIPPAQLFQ-LQ
DSQ  GCTGTGGGCTGGTACCACTACGCTGTTAGCACC...GGGGATGAGGCTCTGCGCGAGAGCTGCCTGCAGTTCCTGGCTTGGAACCTTTCTGCCGTGGCGGGGAGCGCG...GAGTGGGGAGCC...GTGAGCCCCGAGTTGCTGGCGCAGCTCCTGCAGCGCTCGGACCTGGTGCTGCAGGATGAGCTGGAGCTGTTCCACGCGCTGGAGGCGTGGCTGGGCCGCGCGCGGCCG---CCCCCCACCGTGGCCGAGCGAGCGCTG...CGCGCCATCCGCTAC...CCGATGATTCCGCCTGCACAGCTTTTCCAG---CTGCAG
TRN  11011111101111111
NAM  Q6AX46_XENLA/177-277
ASQ  VVSWYHYALRM.GDITLQESCLKFLAWNLSTVMSSN.EWVT.VSDNLMVSLLQRSDLVLQSELELFNAVEEWVSKKNP-DVPVIEKVL.RAIRY.PMITPSQLFQ-IQ
DSQ  GTTGTGAGCTGGTACCATTATGCTCTGAGGATG...GGTGACATAACACTACAGGAAAGCTGTCTGAAGTTTCTGGCATGGAATCTTTCTACTGTTATGAGCAGCAAT...GAGTGGGTGACA...GTGAGTGACAACTTGATGGTATCCCTTCTCCAGCGCTCTGATTTGGTTTTGCAGAGTGAGCTAGAGCTGTTTAATGCTGTAGAGGAATGGGTTAGCAAGAAAAACCCA---GATGTGCCTGTAATTGAAAAGGTCCTT...CGGGCTATCAGGTAT...CCAATGATCACACCAAGCCAGCTCTTCCAG---ATTCAA
TRN  10010101100011011
NAM  Q8IQ29_DROME/76-176
ASQ  CLAIAGMADIY.GIMDLSERAYRYMCAHFEEFATTS.DFKE.MKVDQLRFILSSNYPIDVAEQDLVRLVCSFAIEQQL-NESALGDLL.RLIKW.QHISYKSVDE-LR
DSQ  TGCCTGGCCATTGCGGGAATGGCCGATATCTAT...GGAATTATGGACTTATCCGAACGGGCCTACCGCTATATGTGCGCTCACTTTGAGGAGTTCGCGACCACATCG...GACTTTAAAGAA...ATGAAGGTGGACCAGCTGCGCTTCATCCTCAGCAGCAACTATCCCATTGACGTGGCCGAGCAGGATCTGGTGCGTCTGGTATGCAGCTTTGCGATCGAACAACAGCTG---AATGAGAGCGCTTTGGGGGATCTGCTG...AGGCTGATCAAATGG...CAACACATTAGCTATAAGTCCGTGGACGAA---CTGAGG
TRN  10010101100011010
//