EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07700 - HNOB)
FAM  PF07700
PID  HNOB
DES  Heme NO binding
IPR  IPR011644
ANO  16
ALN  176
AID  0.267392
APH  (((((((O77106_MANSE/1-172:0.22312,(Q80WY4_RAT/1-172:0.32738,Q95NK5_HEMPU/1-172:0.21013):0.08505):0.33743,(GCY35_CAEEL/1-173:0.24988,GCY34_CAEEL/1-173:0.33979):0.59685):0.12060,(Q9VFC5_DROME/18-187:0.57190,(GCY33_CAEEL/1-170:0.57349,(Q7Q9W6_ANOGA/1-170:0.15313,Q9VEU5_DROME/1-170:0.26389):0.50191):0.22589):0.34071):0.25491,Q8YUQ7_ANASP/1-172:0.55815):0.78056,(Q8RBX6_THETN/1-166:0.53732,(Q899J9_CLOTE/20-185:0.29358,Q97E73_CLOAB/1-166:0.26318):0.29732):0.79812):0.19689,Q8EF49_SHEON/1-167:1.02792):0.52212,Q87NJ1_VIBPA/1-168:0.20505,Q8DAE2_VIBVU/1-168:0.26490);
ATP  (((((((O77106_MANSE/1-172,(Q80WY4_RAT/1-172,Q95NK5_HEMPU/1-172)),(GCY35_CAEEL/1-173,GCY34_CAEEL/1-173)),(Q9VFC5_DROME/18-187,(GCY33_CAEEL/1-170,(Q7Q9W6_ANOGA/1-170,Q9VEU5_DROME/1-170)))),Q8YUQ7_ANASP/1-172),(Q8RBX6_THETN/1-166,(Q899J9_CLOTE/20-185,Q97E73_CLOAB/1-166))),Q8EF49_SHEON/1-167),Q87NJ1_VIBPA/1-168,Q8DAE2_VIBVU/1-168);
ATL  11.09
DNO  16
DLN  528
DID  0.408506
DPH  (((((((O77106_MANSE/1-172:0.21828,(Q80WY4_RAT/1-172:0.30369,Q95NK5_HEMPU/1-172:0.23525):0.07660):0.18669,Q8YUQ7_ANASP/1-172:0.58001):0.10826,(GCY35_CAEEL/1-173:0.22966,GCY34_CAEEL/1-173:0.31448):0.27821):0.11474,(Q9VFC5_DROME/18-187:0.52441,(GCY33_CAEEL/1-170:0.52255,(Q7Q9W6_ANOGA/1-170:0.19928,Q9VEU5_DROME/1-170:0.26439):0.25440):0.10962):0.09051):0.47230,((Q87NJ1_VIBPA/1-168:0.25885,Q8DAE2_VIBVU/1-168:0.28560):0.30684,Q8EF49_SHEON/1-167:0.62234):0.15029):0.30329,Q8RBX6_THETN/1-166:0.42218):0.16241,Q899J9_CLOTE/20-185:0.26606,Q97E73_CLOAB/1-166:0.14532);
DTP  (((((((O77106_MANSE/1-172,(Q80WY4_RAT/1-172,Q95NK5_HEMPU/1-172)),Q8YUQ7_ANASP/1-172),(GCY35_CAEEL/1-173,GCY34_CAEEL/1-173)),(Q9VFC5_DROME/18-187,(GCY33_CAEEL/1-170,(Q7Q9W6_ANOGA/1-170,Q9VEU5_DROME/1-170)))),((Q87NJ1_VIBPA/1-168,Q8DAE2_VIBVU/1-168),Q8EF49_SHEON/1-167)),Q8RBX6_THETN/1-166),Q899J9_CLOTE/20-185,Q97E73_CLOAB/1-166);
DTL  8.00652
RID  0.267392
RPH  (((((((O77106_MANSE/1-172:0.22312,(Q80WY4_RAT/1-172:0.32738,Q95NK5_HEMPU/1-172:0.21013):0.08505):0.33743,(GCY35_CAEEL/1-173:0.24988,GCY34_CAEEL/1-173:0.33979):0.59685):0.12060,(Q9VFC5_DROME/18-187:0.57190,(GCY33_CAEEL/1-170:0.57349,(Q7Q9W6_ANOGA/1-170:0.15313,Q9VEU5_DROME/1-170:0.26389):0.50191):0.22589):0.34071):0.25491,Q8YUQ7_ANASP/1-172:0.55815):0.78056,(Q8RBX6_THETN/1-166:0.53732,(Q899J9_CLOTE/20-185:0.29358,Q97E73_CLOAB/1-166:0.26318):0.29732):0.79812):0.19689,Q8EF49_SHEON/1-167:1.02792):0.52212,Q87NJ1_VIBPA/1-168:0.20505,Q8DAE2_VIBVU/1-168:0.26490);
RTP  (((((((O77106_MANSE/1-172,(Q80WY4_RAT/1-172,Q95NK5_HEMPU/1-172)),(GCY35_CAEEL/1-173,GCY34_CAEEL/1-173)),(Q9VFC5_DROME/18-187,(GCY33_CAEEL/1-170,(Q7Q9W6_ANOGA/1-170,Q9VEU5_DROME/1-170)))),Q8YUQ7_ANASP/1-172),(Q8RBX6_THETN/1-166,(Q899J9_CLOTE/20-185,Q97E73_CLOAB/1-166))),Q8EF49_SHEON/1-167),Q87NJ1_VIBPA/1-168,Q8DAE2_VIBVU/1-168);
RTL  11.09
LNK  GCY33_CAEEL/1-170:P90895:AY275181
LNK  GCY34_CAEEL/1-173:P92006:AY652943
LNK  GCY35_CAEEL/1-173:O02298:AY652944
LNK  O77106_MANSE/1-172:O77106:AF062751
LNK  Q7Q9W6_ANOGA/1-170:Q7Q9W6:AAAB01008898
LNK  Q80WY4_RAT/1-172:Q80WY4:AB099521
LNK  Q87NJ1_VIBPA/1-168:Q87NJ1:BA000031
LNK  Q899J9_CLOTE/20-185:Q899J9:AE015936
LNK  Q8DAE2_VIBVU/1-168:Q8DAE2:AE016804
LNK  Q8EF49_SHEON/1-167:Q8EF49:AE015657
LNK  Q8RBX6_THETN/1-166:Q8RBX6:AE013036
LNK  Q8YUQ7_ANASP/1-172:Q8YUQ7:BA000019
LNK  Q95NK5_HEMPU/1-172:Q95NK5:AB062390
LNK  Q97E73_CLOAB/1-166:Q97E73:AE007820
LNK  Q9VEU5_DROME/1-170:Q9VEU5:AE003713
LNK  Q9VFC5_DROME/18-187:Q9VFC5:AE003707
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9VEU5_DROME/1-170
ASQ  MYGMLYESVQHYIQQEYGMETWRKVCQIVDCK-HQSFKTHQIYPDKLMPDFAAALSASTGESFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDN-IHVQMRFTY--PKMKSPSMQLTNM-DDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYG.LDMTAYVLESQND
DSQ  ATGTACGGAATGCTGTACGAGAGCGTGCAGCACTATATCCAGCAGGAGTATGGCATGGAGACCTGGCGAAAGGTCTGCCAGATTGTCGACTGCAAG---CATCAGAGCTTCAAGACACATCAGATCTATCCGGACAAGCTGATGCCGGACTTTGCGGCAGCCCTGTCCGCCAGCACGGGCGAGTCCTTCGACTTCTGCATGAACTTCTTCGGGCGCTGTTTTGTGCGATTCTTCAGCAACTTCGGCTACGACAAGATGATCCGCTCCACAGGGCGATACTTCTGCGACTTCCTGCAGTCCATCGACAAC---ATTCACGTGCAGATGCGTTTCACCTAT------CCCAAGATGAAGTCGCCCAGCATGCAGTTGACCAACATG---GATGACGATGGGGCTGTGATCCTGTACCGCAGCGGCCGAACTGGCATGTCCAAGTACCTGATTGGCCAGATGACCGAGGTGGCCAAGGAGTTCTACGGC...CTAGACATGACTGCCTATGTCCTGGAGAGCCAAAATGAC
TRN  11011111101111111
NAM  Q7Q9W6_ANOGA/1-170
ASQ  MYGMLLESVQHFVQLEYGEFVWRQALLTTGCK-NTVFNTHQLYPDNLIPDLAAALSAITGKPFDEFMIFFGRCFVRFFSNFGYDELIKATGRYFCDFLHSVDN-IHLQMRFTY--RKMKSPSMQLTEV-DENGAVLVYRSTRTGFSKYLRGQLLEIAKQLYG.MDVSIKVLESQND
DSQ  ATGTACGGAATGCTACTGGAGAGTGTTCAACATTTTGTACAGTTGGAGTATGGAGAATTCGTTTGGCGTCAGGCCCTACTCACAACGGGATGTAAA---AATACAGTATTCAACACACACCAGCTTTACCCGGATAATTTGATACCTGACCTTGCAGCAGCACTTTCGGCTATAACAGGAAAACCGTTCGATGAGTTTATGATATTTTTCGGACGATGTTTCGTTCGATTCTTTAGTAATTTCGGTTATGATGAGTTGATCAAGGCAACAGGTCGCTATTTCTGCGATTTTCTACATTCAGTGGATAAC---ATTCACCTGCAGATGCGCTTCACTTAT------CGCAAGATGAAAAGCCCATCTATGCAGCTGACGGAAGTA---GATGAAAATGGTGCCGTACTGGTGTACAGAAGCACACGGACCGGATTCTCGAAGTATCTTCGAGGGCAGCTTTTGGAAATAGCCAAGCAGTTGTACGGG...ATGGACGTCAGCATCAAGGTACTGGAAAGCCAGAACGAT
TRN  10010101100011001
NAM  GCY33_CAEEL/1-170
ASQ  MYGLVIEGVRFMIQENWGPQVLLQVQKLTSLS-EKSVSTHDQYSEHVVPQMFKAIHEITGTPYEQIGVLAGRFFVQFLIRNGYGDLMNVMGRRFSDFIKGLDN-IHEYFRFSY--PKLRAPSFYCKSE-SEDGLILHYRSRRTGYLSYVIGQLVELARVFYQ.LDIGIQVLKKKEK
DSQ  ATGTACGGATTGGTCATTGAAGGTGTTCGGTTTATGATACAGGAAAACTGGGGACCCCAAGTTCTTCTGCAGGTTCAAAAGCTGACATCACTGTCA---GAAAAGTCAGTATCAACTCATGATCAATATTCGGAACACGTTGTTCCTCAAATGTTCAAAGCAATTCATGAAATCACTGGAACACCATATGAACAAATTGGAGTTCTCGCTGGAAGATTTTTCGTTCAATTTTTGATTCGAAATGGTTATGGAGATTTGATGAATGTTATGGGAAGGAGATTTTCGGATTTTATCAAAGGACTTGATAAT---ATTCATGAATATTTTCGATTCAGTTAT------CCAAAACTCAGAGCTCCGTCATTTTACTGTAAATCTGAA---AGTGAAGATGGTTTAATTCTACATTATCGGAGTAGAAGAACTGGATATCTTTCTTATGTAATTGGACAACTTGTTGAATTGGCAAGAGTATTTTATCAA...TTGGATATTGGAATTCAAGTATTGAAAAAGAAAGAAAAA
TRN  10010101100011000
NAM  Q9VFC5_DROME/18-187
ASQ  MYGLLLENLSEYIKSVYGEEKWEDIRRQAGID-SPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDN-LHEYLKFSY--PRMRAPSFICENE-TKQGLTLHYRSKRRGFVYYTMGQIREVARYFYH.KEMHIELVREEIL
DSQ  ATGTACGGACTGCTGCTGGAGAACCTCTCCGAGTACATCAAGTCCGTTTACGGCGAGGAGAAATGGGAGGACATCCGGCGACAGGCTGGCATCGAT---TCGCCCTCCTTCAGCGTCCATCAGGTCTATCCCGAGAATCTGCTGCAGAAGCTGGCGAAAAAGGCTCAACAGGTTCTGGGCGTTTCTGAGCGGGATTTCATGGACCAGATGGGCGTCTACTTCGTGGGCTTTGTGGGCCAGTATGGCTACGATCGTGTCCTTTCCGTCCTGGGCCGCCACATGCGCGACTTTCTCAACGGACTGGACAAC---CTGCATGAGTACCTGAAGTTCTCGTAT------CCGCGGATGAGAGCTCCCAGCTTTATCTGCGAAAACGAA---ACGAAGCAGGGTCTGACCCTGCACTATCGTTCCAAGCGTCGAGGATTCGTCTACTACACGATGGGTCAAATCCGAGAGGTGGCACGGTATTTCTATCAC...AAGGAGATGCATATTGAGCTCGTTCGGGAAGAGATCCTC
TRN  10010101100011011
NAM  Q95NK5_HEMPU/1-172
ASQ  MYGFVNHALELLVLREHGKDKWEEIKREAAVEIEGSFLVRIVYDDVLSYDLVGAAVKVLEISANDLLEAFGRMFFEFCVESGYDNILNVLGSTTRHFLQNLDA-LHDHLASIY--PGMRAPSFRCSTRESDGALVLHYYSERPGLEHIVIGLVRSVAKTLHG.SEVHVEIIKNKGE
DSQ  ATGTATGGATTCGTTAATCACGCTTTGGAGCTGCTGGTTCTTCGAGAACATGGCAAAGACAAATGGGAAGAAATCAAACGCGAAGCCGCAGTGGAGATCGAAGGCAGTTTCTTAGTCCGAATCGTGTATGATGATGTCTTATCTTATGATCTAGTCGGAGCCGCCGTCAAAGTACTCGAAATAAGTGCCAATGATCTGTTGGAGGCATTCGGTCGGATGTTCTTTGAATTTTGCGTCGAGTCTGGCTACGACAACATCTTGAACGTCCTCGGTTCAACCACACGTCACTTCTTGCAGAACTTAGATGCT---CTTCACGATCATCTTGCCTCAATCTAC------CCGGGAATGCGAGCACCTTCATTCAGATGCAGTACACGAGAGAGTGACGGTGCTCTTGTCCTTCACTACTACTCCGAGCGACCAGGGCTGGAGCACATCGTCATCGGGTTGGTACGCAGTGTGGCAAAGACCCTCCATGGC...TCCGAAGTCCATGTCGAGATCATCAAGAATAAAGGAGAA
TRN  10010101100011000
NAM  O77106_MANSE/1-172
ASQ  MYGFVNYALELLVMKTFDEETWETIKKKADVAMEGSFLVRQIYEDEITYNLITAAVEVLQIPADAILELFGKTFFEFCQDSGYDKILQVLGATPRDFLQNLDG-LHDHLGTLY--PGMRSPSFRCTERPEDGALVLHYYSDRPGLEHIVIGIVKTVASKLHN.TEVKVEILKTKEE
DSQ  ATGTACGGGTTTGTGAACTATGCCCTCGAGCTCCTTGTGATGAAAACTTTTGACGAAGAAACATGGGAGACGATAAAGAAAAAGGCCGACGTGGCTATGGAAGGCAGTTTCCTAGTGAGACAGATTTATGAGGATGAGATCACTTATAATTTGATCACCGCTGCCGTTGAGGTCTTGCAAATACCCGCTGACGCTATATTGGAGCTATTTGGAAAAACGTTCTTCGAGTTTTGCCAAGATTCCGGGTATGATAAAATTCTGCAAGTACTTGGAGCCACGCCACGAGATTTTCTACAGAATCTGGACGGC---CTGCACGATCATCTCGGGACATTATAT------CCTGGCATGAGATCCCCCTCGTTCCGATGCACCGAGCGTCCTGAAGATGGCGCCCTTGTGCTTCATTATTACTCCGACAGGCCTGGTCTGGAGCATATCGTTATTGGAATTGTAAAGACTGTGGCGAGCAAACTCCATAAC...ACCGAAGTGAAGGTGGAAATCCTAAAGACCAAAGAGGAA
TRN  10010101100011010
NAM  Q80WY4_RAT/1-172
ASQ  MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYGTILRVLGSNVREFLQNLDA-LHDHLATIY--PGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHG.TEIDMKVIQQRSE
DSQ  ATGTACGGTTTTGTGAACCATGCCCTGGAGCTGCTGGTGATCCGCAATTACGGTCCCGAGGTGTGGGAAGACATCAAAAAAGAGGCGCAGCTGGATGAAGAAGGCCAGTTTCTTGTGAGAATAATCTACGATGATTCCAAAACCTATGACTTGGTGGCTGCTGCGAGCAAAGTCCTCAACCTCAATGCTGGTGAAATCCTGCAGATGTTTGGGAAGATGTTTTTCGTCTTCTGTCAAGAGTCTGGCTATGGTACCATCTTGCGTGTCCTGGGATCTAATGTCAGGGAGTTTTTGCAGAACCTCGACGCC---CTGCACGACCACCTCGCCACCATCTAC------CCAGGGATGCGCGCACCTTCCTTCCGGTGCACCGATGCAGAAAAAGGCAAAGGGCTCATTCTGCACTACTACTCGGAAAGAGAGGGGCTTCAGGACATTGTGATCGGGATTATCAAGACTGTAGCTCAACAGATCCATGGC...ACTGAGATAGACATGAAGGTTATTCAGCAAAGAAGTGAA
TRN  10010101100011011
NAM  Q8YUQ7_ANASP/1-172
ASQ  MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDN-LHARVGLSF--PQLRPPAFECQHT-SSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTkVEVTQTAFRETGE
DSQ  ATGTATGGTTTAGTGAACAAAGCCATTCAAGACATGATTAGCAAGCATCACGGCGAAGATACATGGGAAGCCATCAAGCAAAAAGCCGGACTGGAAGATATTGATTTTTTCGTAGGGATGGAAGCTTATAGTGATGATGTTACTTATCATTTGGTTGGTGCCGCTAGTGAAGTATTGGGTAAGCCTGCCGAGGAACTGCTGATAGCCTTTGGGGAATACTGGGTGACATATACATCCGAAGAAGGCTATGGAGAACTTTTAGCTAGTGCGGGAGACTCTTTACCAGAGTTTATGGAAAACCTTGATAAC---CTTCATGCCAGAGTAGGCTTAAGTTTT------CCTCAGCTTCGTCCCCCCGCTTTTGAGTGTCAACACACC---AGTAGCAAGTCGATGGAACTCCACTACCAATCAACTCGCTGTGGTTTAGCTCCAATGGTGCTTGGTTTACTCCACGGATTAGGGAAACGCTTTCAGACAaaaGTTGAAGTTACTCAAACCGCTTTTCGTGAGACTGGTGAG
TRN  10010101100011000
NAM  GCY34_CAEEL/1-173
ASQ  MFGFIHESIRQLVIRKYGEDVWLQVLERSGFENGKENIVNHYYSDTDTYVLVDSVSIVLKVTKDQIWEMYGGFLITYSMEIGWDELVRSMSPNLKGFLDNLDS-LHYFIDHVVYKANLRGPSFRCEEN-PDGTLMLHYFTGRPGLYHIVKGVVKEVAKLVFN.LDISLVVQGRTQR
DSQ  ATGTTTGGTTTCATTCATGAAAGTATTCGACAACTTGTTATTCGAAAATATGGTGAAGATGTGTGGTTGCAAGTTCTTGAGCGATCTGGATTTGAAAACGGGAAAGAAAATATTGTCAACCATTATTATTCGGATACAGACACGTATGTTCTTGTGGACAGTGTTTCAATCGTCTTGAAAGTGACAAAAGATCAAATTTGGGAGATGTATGGAGGATTTTTGATAACATATTCCATGGAGATTGGATGGGATGAATTGGTCCGAAGTATGAGTCCAAATCTGAAAGGATTCCTGGATAATCTTGACAGT---CTTCACTATTTCATTGACCATGTTGTCTATAAAGCAAATCTTCGAGGACCATCATTTCGCTGTGAGGAGAAC---CCAGATGGAACATTGATGCTTCATTATTTCACTGGTCGCCCTGGACTTTATCATATTGTGAAGGGGGTTGTTAAGGAAGTTGCTAAATTGGTATTCAAC...TTAGATATCAGTCTTGTGGTTCAAGGAAGAACTCAGAGG
TRN  10010101100011000
NAM  GCY35_CAEEL/1-173
ASQ  MFGWIHESFRQLVTRKYGKDIWEKIVHMSKFELGTESEIAHYYNDDETLRLVNSMANVIGIPIEEIWEAYGGFLIQFTMETGWDELLRAMAPDLEGFLDSLDS-LHYFIDHVVYKTKLRGPSFRCDVQ-ADGTLLLHYYSKRSGLYPIVKGVVREVARRIYD.TEVVMKVQERKQE
DSQ  ATGTTCGGCTGGATTCACGAAAGCTTCAGGCAACTTGTCACAAGGAAATATGGAAAAGATATTTGGGAGAAGATCGTGCACATGTCAAAATTCGAGTTGGGAACTGAAAGTGAAATTGCTCATTATTATAATGACGATGAAACTCTGCGTCTTGTCAATTCAATGGCAAATGTGATTGGAATTCCAATTGAGGAAATTTGGGAGGCTTATGGAGGTTTTTTGATTCAATTTACAATGGAAACCGGATGGGATGAACTGCTCAGAGCAATGGCTCCGGATTTGGAGGGCTTCTTGGATTCCCTTGACTCA---CTTCACTATTTCATTGATCACGTCGTGTACAAGACAAAACTCCGTGGTCCATCATTTCGATGTGATGTTCAG---GCAGATGGAACTCTTCTTCTTCATTATTACTCGAAGCGCAGTGGTTTATATCCTATTGTTAAAGGCGTTGTAAGAGAAGTGGCTCGTCGTATCTATGAC...ACAGAAGTTGTCATGAAAGTTCAAGAACGAAAACAGGAA
TRN  10010101100011000
NAM  Q97E73_CLOAB/1-166
ASQ  MKGTVVGTWVKTCKRLYGETVVENALEKVGFERKKIFSPFEDVEDSKVNNFIEDISKKVNEEKSIIWEKIGEDNVIAFHKDFPA---FFEHENLYSFFKSMFD-VHVVMTKKF--PGAKPPLILIKPI-SKREAIFTYRSKR-GMFDYLKGLIKGSANHFNE.-KIEIEEVEKTKE
DSQ  ATGAAGGGAACAGTAGTAGGAACATGGGTAAAAACCTGCAAAAGATTATATGGTGAAACTGTAGTAGAAAATGCACTTGAAAAAGTTGGCTTTGAAAGAAAAAAGATATTTTCTCCATTTGAAGATGTTGAAGATAGCAAAGTAAATAATTTTATTGAAGATATATCAAAGAAGGTTAATGAGGAGAAAAGCATAATATGGGAAAAGATAGGTGAGGATAATGTAATTGCCTTTCACAAAGATTTTCCCGCT---------TTCTTTGAACATGAAAATTTATATTCCTTTTTTAAATCTATGTTTGAT---GTGCACGTGGTTATGACTAAAAAGTTT------CCAGGAGCTAAGCCACCTCTTATATTGATAAAACCAATA---TCTAAGAGAGAAGCAATCTTTACATATAGGTCTAAAAGA---GGAATGTTTGATTACTTAAAAGGACTTATAAAAGGTAGTGCTAATCATTTTAATGAG...---AAAATTGAAATTGAAGAGGTAGAAAAAACAAAAGAA
TRN  10010101110011000
NAM  Q899J9_CLOTE/20-185
ASQ  MKGTIVATWMRTCRKLYNDDVVNKAMSSVGWDSNKIFKPTENVEDSDLKKVIEYIAKSEKLELGHLWRQIGKDNLVSFYNDFPA---FFQHENLYSFFNSLFD-IHVVMTKKF--PGAKPPLVTIEPI-SSKEAIFYYESKR-GMFDYLLGLIEGSIKYFKE.-DIEIEELERTNE
DSQ  ATGAAAGGAACTATAGTAGCTACTTGGATGAGAACCTGCAGGAAGCTTTATAATGATGATGTAGTAAATAAAGCTATGAGTTCAGTAGGTTGGGATAGTAATAAGATTTTTAAACCAACAGAAAATGTAGAAGATAGTGATCTAAAAAAAGTAATTGAATACATTGCCAAGTCTGAGAAGTTAGAATTAGGACATTTATGGAGACAAATAGGAAAAGATAATTTAGTTTCCTTTTATAATGATTTTCCTGCA---------TTTTTTCAACATGAAAATTTATATTCATTTTTCAATTCTCTTTTTGAC---ATACATGTGGTTATGACTAAAAAATTT------CCAGGTGCTAAGCCACCACTAGTAACAATAGAACCTATA---TCCAGTAAAGAAGCTATTTTCTATTATGAATCTAAAAGA---GGAATGTTTGATTATCTTTTAGGACTTATAGAGGGAAGCATAAAGTATTTTAAAGAG...---GATATAGAGATAGAGGAATTAGAAAGAACTAATGAA
TRN  10010101110011000
NAM  Q8RBX6_THETN/1-166
ASQ  MKGTIVGTWIKTLRDLYGNDVVDESLKSVGWEPDRVITPLEDIDDDEVRRIFAKVSEKTGKNVNEIWREVGRQNIKTFSEWFPS---YFAGRRLVNFLMMMDE-VHLQLTKMI--KGATPPRLIAKPV-AKDAIEMEYVSKR-KMYDYFLGLIEGSSKFFKE.-EISVEEVERGEK
DSQ  ATGAAGGGGACAATCGTCGGGACATGGATAAAGACCCTGAGGGACCTTTACGGGAATGATGTGGTTGATGAATCTTTAAAAAGTGTGGGTTGGGAACCAGATAGGGTAATTACACCTCTGGAGGATATTGATGACGATGAGGTTAGGAGAATTTTTGCTAAGGTGAGTGAAAAAACTGGTAAAAATGTCAACGAAATATGGAGAGAGGTAGGAAGGCAGAACATAAAAACTTTCAGCGAATGGTTTCCCTCC---------TATTTTGCAGGGAGAAGGCTAGTGAATTTTTTAATGATGATGGATGAG---GTACACCTACAGCTTACCAAGATGATA------AAAGGAGCCACTCCTCCAAGGCTTATTGCAAAGCCTGTT---GCAAAAGATGCCATTGAAATGGAGTACGTTTCTAAAAGA---AAGATGTACGATTACTTTTTAGGGCTTATAGAGGGTAGTTCTAAATTTTTCAAGGAA...---GAAATTTCAGTGGAAGAGGTCGAAAGAGGCGAAAAA
TRN  10010101100011000
NAM  Q8EF49_SHEON/1-167
ASQ  MKGIIFNVLEDMVVAQCGMSVWNELLEKHAPK-DRVYVSAKSYAESELFSIVQDVAQRLNMPIQDVVKAFGQFLFNGLASRHTD--VVDKFDDFTSLVMGIHDVIHLEVNKLY--HEPSLPHINGQLL-PNNQIALRYSSPR-RLCFCAEGLLFGAAQHFQQ.-KIQISHDTCMHT
DSQ  ATGAAAGGAATTATTTTTAATGTGCTGGAAGATATGGTCGTAGCCCAGTGCGGAATGTCAGTTTGGAACGAACTATTGGAAAAACATGCTCCTAAG---GATCGCGTGTATGTGTCAGCCAAAAGCTATGCTGAGTCTGAGTTATTTAGCATTGTTCAGGATGTAGCACAGCGGCTTAATATGCCGATACAGGATGTAGTCAAAGCATTTGGGCAGTTTCTTTTTAATGGGCTAGCCTCCCGTCATACCGAT------GTTGTAGACAAGTTTGACGATTTTACCTCCTTAGTCATGGGGATCCATGATGTGATCCATTTAGAGGTGAATAAGCTATAC------CATGAGCCTTCGTTGCCGCACATTAATGGACAGTTATTA---CCGAACAATCAAATTGCGTTAAGGTATTCATCCCCCCGT---CGGTTATGTTTTTGCGCAGAGGGACTGTTATTTGGTGCTGCGCAGCATTTTCAGCAA...---AAGATCCAGATTAGCCATGACACTTGCATGCATACT
TRN  10010101100011000
NAM  Q8DAE2_VIBVU/1-168
ASQ  MKGIIFTEFLELVEEKFGLTVLDDILDRAGDE--GVYTAVGSYDHRKLVSLIVHLSQVTGLSVEQLQEVFGEAVFDNLLASISNRSSLHQCHSTFQFIRHVEEYIHVEVKKLY--PDAKPPEFIFIEQ-DRMKMVFDYKSAR-CMGHVCLGLMRGCAKHFGE.-ELAIQMETLNPT
DSQ  ATGAAGGGAATCATTTTCACTGAATTTTTGGAATTGGTCGAAGAGAAATTTGGTTTGACCGTACTGGACGATATTTTGGACAGGGCAGGAGATGAG------GGTGTCTACACCGCAGTAGGGAGCTACGACCACCGAAAACTGGTCAGTTTGATTGTGCATCTTAGCCAAGTGACGGGGCTGTCTGTTGAGCAGTTGCAAGAGGTCTTCGGTGAGGCCGTGTTCGACAACTTATTGGCGTCCATTTCTAATCGTTCAAGCCTGCATCAATGTCACTCAACCTTTCAGTTTATTCGCCATGTGGAAGAGTATATCCATGTTGAGGTGAAGAAACTCTAC------CCCGATGCCAAGCCACCGGAATTTATCTTCATCGAACAA---GATCGAATGAAGATGGTGTTTGACTACAAAAGCGCGCGT---TGCATGGGGCATGTTTGCCTTGGATTGATGAGAGGGTGTGCCAAGCATTTTGGCGAA...---GAACTGGCGATACAGATGGAGACACTCAACCCAACA
TRN  10010101100011000
NAM  Q87NJ1_VIBPA/1-168
ASQ  MKGIIFTEFMELVESKFGLEVLDQVLELSDDE--GVYTSVGSYDHRDLVKLIVNLSKVSDIPPEQLQEVFGESVFLNLLRSIPSHASLQQCDNTFQFVRHVESFIHVEVKKLY--PDANPPKFDFISE-TQSELVFDYHSAR-CMAHVCLGLLKGCAAHFGQ.-VIHIMHQNQTED
DSQ  ATGAAAGGGATAATCTTTACCGAGTTCATGGAGTTAGTGGAAAGCAAATTTGGACTTGAAGTGCTTGACCAAGTGCTCGAACTTTCCGATGACGAA------GGGGTATATACCTCTGTCGGCAGCTATGATCACCGGGACTTAGTCAAACTGATCGTCAATCTCAGCAAAGTTTCTGATATTCCCCCAGAGCAGTTACAAGAAGTGTTTGGTGAAAGCGTATTTTTGAACCTGCTACGCTCCATTCCCAGTCATGCAAGCTTGCAACAGTGCGACAATACCTTTCAATTTGTTCGACATGTAGAAAGCTTTATTCATGTAGAAGTTAAAAAACTTTAC------CCAGACGCCAATCCGCCTAAGTTCGATTTTATCAGCGAA---ACACAGTCAGAACTGGTGTTCGACTACCACAGTGCAAGG---TGTATGGCGCATGTTTGTTTAGGGTTGCTCAAAGGTTGTGCTGCGCACTTTGGACAG...---GTCATTCATATTATGCATCAAAACCAAACCGAAGAC
TRN  10010101100011000
//