EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07694 - 5TM-5TMR_LYT)
FAM  PF07694
PID  5TM-5TMR_LYT
DES  5TMR of 5TMR-LYT
IPR  IPR011620
ANO  27
ALN  108
AID  0.266382
APH  (((((((Q8EGU1_SHEON/18-112:1.06476,(Q9RVD9_DEIRA/32-118:0.13741,Q9RYX3_DEIRA/36-123:0.56862):1.19198):0.73849,(LYTS_OCEIH/37-139:1.06451,(((((LYTS_STRMU/34-137:0.53553,Q8DZT0_STRA5/36-138:0.51991):0.06532,(LYTS_ENTFA/37-139:0.34236,(LYTS_STAAM/37-139:0.44826,LYTS_STAEP/37-139:0.18701):0.34912):0.17683):0.31903,(LYTS_BACCR/37-139:0.25495,LYTS_BACSU/37-139:0.33733):0.18028):0.12441,(Q8RBE9_THETN/38-124:0.39257,((Q892V8_CLOTE/37-140:0.43325,Q7P590_FUSNV/39-127:0.62122):0.18334,((Q87S85_VIBPA/36-122:0.17829,Q8EDD8_SHEON/36-122:0.31884):0.06296,(YEHU_ECOLI/39-125:0.15452,Q7NXG1_CHRVO/64-150:0.16088):0.04802):0.37513):0.10207):0.27563):0.13716,YPDA_ECOLI/41-129:0.61244):0.17792):0.67860):0.17765,Q97DD4_CLOAB/29-121:1.81936):0.45764,(Q814L4_BACCR/33-121:0.23609,Q81JN9_BACAN/33-119:0.16988):0.78473):0.18711,(Q8Y595_LISMO/32-120:0.11201,Q929J8_LISIN/32-120:0.18336):0.22137):0.51501,YHCK_BACSU/33-119:0.69280):1.38851,Q8CTF5_STAEP/30-117:0.34689,Q99VM8_STAAN/30-116:0.07493);
ATP  (((((((Q8EGU1_SHEON/18-112,(Q9RVD9_DEIRA/32-118,Q9RYX3_DEIRA/36-123)),(LYTS_OCEIH/37-139,(((((LYTS_STRMU/34-137,Q8DZT0_STRA5/36-138),(LYTS_ENTFA/37-139,(LYTS_STAAM/37-139,LYTS_STAEP/37-139))),(LYTS_BACCR/37-139,LYTS_BACSU/37-139)),(Q8RBE9_THETN/38-124,((Q892V8_CLOTE/37-140,Q7P590_FUSNV/39-127),((Q87S85_VIBPA/36-122,Q8EDD8_SHEON/36-122),(YEHU_ECOLI/39-125,Q7NXG1_CHRVO/64-150))))),YPDA_ECOLI/41-129))),Q97DD4_CLOAB/29-121),(Q814L4_BACCR/33-121,Q81JN9_BACAN/33-119)),(Q8Y595_LISMO/32-120,Q929J8_LISIN/32-120)),YHCK_BACSU/33-119),Q8CTF5_STAEP/30-117,Q99VM8_STAAN/30-116);
ATL  21.2315
DNO  27
DLN  324
DID  0.404343
DPH  (((((Q8EGU1_SHEON/18-112:0.33670,(Q9RVD9_DEIRA/32-118:0.12976,Q9RYX3_DEIRA/36-123:0.37697):0.72697):0.37012,(LYTS_OCEIH/37-139:0.48451,(((Q892V8_CLOTE/37-140:0.36036,Q7P590_FUSNV/39-127:0.32467):0.15207,Q8RBE9_THETN/38-124:0.28542):0.05005,((YPDA_ECOLI/41-129:0.49723,((LYTS_BACCR/37-139:0.24939,LYTS_BACSU/37-139:0.26943):0.08471,((Q87S85_VIBPA/36-122:0.22803,(YEHU_ECOLI/39-125:0.20518,Q7NXG1_CHRVO/64-150:0.20308):0.07233):0.09404,Q8EDD8_SHEON/36-122:0.19191):0.32571):0.03153):0.09593,(((LYTS_ENTFA/37-139:0.26081,(LYTS_STAAM/37-139:0.29366,LYTS_STAEP/37-139:0.20911):0.18115):0.10950,Q8DZT0_STRA5/36-138:0.38583):0.15850,LYTS_STRMU/34-137:0.37812):0.21538):0.10585):0.13245):0.20906):0.12705,Q97DD4_CLOAB/29-121:0.75371):0.17726,(YHCK_BACSU/33-119:0.61968,((Q814L4_BACCR/33-121:0.19376,Q81JN9_BACAN/33-119:0.18020):0.46634,(Q8Y595_LISMO/32-120:0.13866,Q929J8_LISIN/32-120:0.22143):0.15526):0.10581):0.00523):0.80080,Q8CTF5_STAEP/30-117:0.14128,Q99VM8_STAAN/30-116:0.34192);
DTP  (((((Q8EGU1_SHEON/18-112,(Q9RVD9_DEIRA/32-118,Q9RYX3_DEIRA/36-123)),(LYTS_OCEIH/37-139,(((Q892V8_CLOTE/37-140,Q7P590_FUSNV/39-127),Q8RBE9_THETN/38-124),((YPDA_ECOLI/41-129,((LYTS_BACCR/37-139,LYTS_BACSU/37-139),((Q87S85_VIBPA/36-122,(YEHU_ECOLI/39-125,Q7NXG1_CHRVO/64-150)),Q8EDD8_SHEON/36-122))),(((LYTS_ENTFA/37-139,(LYTS_STAAM/37-139,LYTS_STAEP/37-139)),Q8DZT0_STRA5/36-138),LYTS_STRMU/34-137))))),Q97DD4_CLOAB/29-121),(YHCK_BACSU/33-119,((Q814L4_BACCR/33-121,Q81JN9_BACAN/33-119),(Q8Y595_LISMO/32-120,Q929J8_LISIN/32-120)))),Q8CTF5_STAEP/30-117,Q99VM8_STAAN/30-116);
DTL  13.88
RID  0.266382
RPH  (((((((Q8EGU1_SHEON/18-112:1.06476,(Q9RVD9_DEIRA/32-118:0.13741,Q9RYX3_DEIRA/36-123:0.56862):1.19198):0.73849,(LYTS_OCEIH/37-139:1.06451,(((((LYTS_STRMU/34-137:0.53553,Q8DZT0_STRA5/36-138:0.51991):0.06532,(LYTS_ENTFA/37-139:0.34236,(LYTS_STAAM/37-139:0.44826,LYTS_STAEP/37-139:0.18701):0.34912):0.17683):0.31903,(LYTS_BACCR/37-139:0.25495,LYTS_BACSU/37-139:0.33733):0.18028):0.12441,(Q8RBE9_THETN/38-124:0.39257,((Q892V8_CLOTE/37-140:0.43325,Q7P590_FUSNV/39-127:0.62122):0.18334,((Q87S85_VIBPA/36-122:0.17829,Q8EDD8_SHEON/36-122:0.31884):0.06296,(YEHU_ECOLI/39-125:0.15452,Q7NXG1_CHRVO/64-150:0.16088):0.04802):0.37513):0.10207):0.27563):0.13716,YPDA_ECOLI/41-129:0.61244):0.17792):0.67860):0.17765,Q97DD4_CLOAB/29-121:1.81936):0.45764,(Q814L4_BACCR/33-121:0.23609,Q81JN9_BACAN/33-119:0.16988):0.78473):0.18711,(Q8Y595_LISMO/32-120:0.11201,Q929J8_LISIN/32-120:0.18336):0.22137):0.51501,YHCK_BACSU/33-119:0.69280):1.38851,Q8CTF5_STAEP/30-117:0.34689,Q99VM8_STAAN/30-116:0.07493);
RTP  (((((((Q8EGU1_SHEON/18-112,(Q9RVD9_DEIRA/32-118,Q9RYX3_DEIRA/36-123)),(LYTS_OCEIH/37-139,(((((LYTS_STRMU/34-137,Q8DZT0_STRA5/36-138),(LYTS_ENTFA/37-139,(LYTS_STAAM/37-139,LYTS_STAEP/37-139))),(LYTS_BACCR/37-139,LYTS_BACSU/37-139)),(Q8RBE9_THETN/38-124,((Q892V8_CLOTE/37-140,Q7P590_FUSNV/39-127),((Q87S85_VIBPA/36-122,Q8EDD8_SHEON/36-122),(YEHU_ECOLI/39-125,Q7NXG1_CHRVO/64-150))))),YPDA_ECOLI/41-129))),Q97DD4_CLOAB/29-121),(Q814L4_BACCR/33-121,Q81JN9_BACAN/33-119)),(Q8Y595_LISMO/32-120,Q929J8_LISIN/32-120)),YHCK_BACSU/33-119),Q8CTF5_STAEP/30-117,Q99VM8_STAAN/30-116);
RTL  21.2315
LNK  LYTS_BACCR/37-139:Q814J0:AE017015
LNK  LYTS_BACSU/37-139:P94513:Z75208
LNK  LYTS_ENTFA/37-139:Q82Z75:AE016957
LNK  LYTS_OCEIH/37-139:Q8EQQ2:AP004598
LNK  LYTS_STAAM/37-139:P60612:AP003358
LNK  LYTS_STAEP/37-139:Q8CR79:AE016750
LNK  LYTS_STRMU/34-137:Q8DVB6:AE014902
LNK  Q7NXG1_CHRVO/64-150:Q7NXG1:AE016915
LNK  Q7P590_FUSNV/39-127:Q7P590:AABF01000079
LNK  Q814L4_BACCR/33-121:Q814L4:AE017015
LNK  Q81JN9_BACAN/33-119:Q81JN9:AE017041
LNK  Q87S85_VIBPA/36-122:Q87S85:BA000031
LNK  Q892V8_CLOTE/37-140:Q892V8:AE015942
LNK  Q8CTF5_STAEP/30-117:Q8CTF5:AE016745
LNK  Q8DZT0_STRA5/36-138:Q8DZT0:AE014238
LNK  Q8EDD8_SHEON/36-122:Q8EDD8:AE015721
LNK  Q8EGU1_SHEON/18-112:Q8EGU1:AE015596
LNK  Q8RBE9_THETN/38-124:Q8RBE9:AE013054
LNK  Q8Y595_LISMO/32-120:Q8Y595:AL591982
LNK  Q929J8_LISIN/32-120:Q929J8:AL596171
LNK  Q97DD4_CLOAB/29-121:Q97DD4:AE007850
LNK  Q99VM8_STAAN/30-116:Q99VM8:BA000018
LNK  Q9RVD9_DEIRA/32-118:Q9RVD9:AE001959
LNK  Q9RYX3_DEIRA/36-123:Q9RYX3:AE001862
LNK  YEHU_ECOLI/39-125:P33357:U00007
LNK  YHCK_BACSU/33-119:P54595:X96983
LNK  YPDA_ECOLI/41-129:P76523:U00096
AMK  xxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9RYX3_DEIRA/36-123
ASQ  DSRLQVPRFLLVSL.MCVPLMFFPAQV--------.-------APGVFVDLRAVPIAFLTLRLGWGWGLVGAVPLLVYRYLL--GGVGWPPAMVSAIGV.VLVAGLFH
DSQ  GACTCTCGTCTCCAGGTGCCACGCTTCCTGCTCGTTTCGCTG...ATGTGCGTGCCGCTGATGTTTTTTCCGGCGCAGGTG------------------------...---------------------GCGCCTGGGGTCTTTGTTGACCTGCGAGCAGTGCCGATTGCTTTCCTGACCCTCCGCCTGGGCTGGGGCTGGGGGCTGGTGGGCGCCGTGCCGCTGCTCGTCTACCGCTACCTGCTG------GGCGGCGTGGGCTGGCCGCCGGCCATGGTGAGTGCGATCGGTGTG...GTGCTGGTGGCGGGGCTCTTTCAT
TRN  11011111101111111
NAM  Q9RVD9_DEIRA/32-118
ASQ  TAIH-VPRLLLLAV.MAVVLMLYPAEV--------.-------APGVIIDMRAVPIAYLALRKGVWAGLLALIPLLLYRFHL--GGVGTWSAVFSAVGV.VLLGGLLH
DSQ  ACGGCCATTCAT---GTGCCGCGGCTGTTGCTGCTGGCAGTG...ATGGCGGTTGTCCTAATGCTCTATCCGGCGGAGGTG------------------------...---------------------GCGCCGGGCGTCATCATCGACATGCGGGCGGTGCCAATCGCCTACCTGGCCCTCCGCAAGGGCGTGTGGGCGGGGCTGCTGGCCCTGATTCCGCTGCTGCTCTACCGCTTTCATCTG------GGTGGGGTCGGAACCTGGAGTGCAGTGTTCAGCGCCGTGGGGGTG...GTGTTGCTGGGCGGCCTGCTGCAC
TRN  11011111101111111
NAM  Q8EGU1_SHEON/18-112
ASQ  PKKHQRQYFLLWRLgIGVLIGGIGVAIMSTP----.----WMYEPGIIFDTRSVLLCVSGLFFGGLPTAIAVVITALYRLSI--GGVAMWVGVGVIITS.GLI-GVIW
DSQ  CCTAAAAAGCATCAGCGGCAGTATTTTTTACTCTGGCGGCTGggaATTGGCGTACTCATAGGTGGCATTGGTGTCGCGATTATGAGTACACCA------------...------------TGGATGTATGAACCTGGGATTATTTTCGATACCCGCTCAGTGCTTTTATGTGTTTCAGGTTTATTTTTTGGCGGTTTGCCAACGGCAATCGCCGTGGTTATCACTGCGCTTTATCGGCTGAGTATT------GGTGGTGTTGCCATGTGGGTTGGGGTTGGAGTGATTATTACCTCT...GGCCTTATT---GGCGTGATATGG
TRN  10010101100011000
NAM  Q929J8_LISIN/32-120
ASQ  SINRKMVIGVWAGL.LGFALMIFGIPI--------.-------SNNVIVDLRHIPIIMVGFYGGPIPAIVSAVIITTSRFLISVNSAAVMAGVIMML-I.GIITALFS
DSQ  TCGATAAATAGAAAAATGGTGATAGGTGTATGGGCAGGGCTG...CTAGGATTTGCACTAATGATTTTTGGGATACCGATT------------------------...---------------------TCAAATAATGTAATTGTTGATTTGCGTCATATTCCTATTATTATGGTGGGCTTTTACGGCGGGCCCATTCCGGCAATTGTTTCGGCGGTCATTATTACAACTTCACGCTTTTTAATTTCAGTGAATTCTGCAGCAGTGATGGCTGGTGTAATCATGATGTTG---ATT...GGCATTATAACAGCTCTTTTTAGC
TRN  10010101100011000
NAM  Q8Y595_LISMO/32-120
ASQ  STNKKIVIGIWAGL.LGFALMVFGIPI--------.-------SNNVIVDLRHIPIIMVGFYGGPIPAIVSAIIISASRFLL-SVNSAAIMAAVVMMLI.GIITAIFG
DSQ  TCAACAAATAAAAAAATAGTAATCGGAATTTGGGCTGGACTT...CTCGGTTTTGCGCTGATGGTTTTCGGGATTCCAATT------------------------...---------------------TCGAATAATGTGATTGTCGATTTACGTCACATTCCAATAATAATGGTAGGCTTTTATGGTGGGCCGATTCCCGCGATTGTATCAGCTATTATCATTTCAGCATCGCGCTTTTTATTA---TCTGTGAATTCCGCAGCTATTATGGCGGCTGTTGTGATGATGTTAATC...GGCATAATAACAGCAATTTTTGGC
TRN  10010101100011000
NAM  YHCK_BACSU/33-119
ASQ  SISFQAVKGLACGL.LGVILMVFGFTY--------.--------QHSIIDLRNIPIMIAALYGGWVSTATALAMITAGRLLI--TMNTSALYSVIIICI.AAIPSLIV
DSQ  AGCATATCCTTTCAAGCTGTTAAAGGACTGGCCTGCGGTTTG...CTCGGGGTTATTCTGATGGTTTTTGGATTTACCTAT------------------------...------------------------CAGCATTCAATTATTGATCTTCGAAATATCCCTATTATGATTGCCGCTCTTTATGGAGGCTGGGTTTCAACGGCAACGGCCCTGGCCATGATCACTGCAGGCCGCTTGCTGATT------ACGATGAACACATCTGCACTATACTCGGTTATTATCATTTGTATC...GCTGCCATTCCGTCACTCATTGTT
TRN  10010101100011001
NAM  Q81JN9_BACAN/33-119
ASQ  SFWQKCVVGILTGI.LSVLLMYFGVHI--------.--------ENIMLDLRYLAVILAIIIGGPIASSITVTIILITRLFLTEYSLASELACYTIVLI.GI--GVTF
DSQ  TCCTTTTGGCAGAAATGTGTAGTTGGTATTCTTACTGGAATA...TTAAGTGTACTGTTGATGTATTTTGGTGTACATATT------------------------...------------------------GAAAATATTATGTTGGATCTACGTTATTTAGCGGTTATTTTGGCAATTATAATCGGAGGTCCGATAGCTAGTAGTATAACAGTTACGATCATTTTAATTACCCGATTATTTTTAACCGAGTACTCTTTAGCCTCTGAATTGGCTTGTTATACTATTGTATTGATA...GGTATT------GGGGTTACTTTC
TRN  10010101100011010
NAM  Q814L4_BACCR/33-121
ASQ  SFGQKCVVGIFTGI.LGILLMYFGVRV--------.--------GTILLDLRYLAVILAVIIGGPIASTITIIMILVTRLLFMDYSLASQVAFYTIIAI.GIGSIFIS
DSQ  TCTTTTGGGCAGAAATGTGTAGTAGGCATTTTTACTGGGATA...CTAGGTATATTACTAATGTATTTCGGTGTTCGTGTT------------------------...------------------------GGTACCATCCTATTGGATTTACGCTACTTAGCTGTTATTCTAGCTGTTATTATTGGAGGGCCGATAGCGAGTACCATAACAATTATTATGATTTTAGTAACTAGACTGTTGTTTATGGATTATTCATTAGCTTCTCAAGTGGCCTTTTATACAATCATTGCGATA...GGAATAGGGAGTATCTTTATTTCG
TRN  10010101100011000
NAM  Q8RBE9_THETN/38-124
ASQ  TKKDLLITMLIFGL.IGIAGTYLGVPI--------.--------NDAIANSRVVGPMVAGLIGGPLVGLGAGLIAGVHRFFL--GGFTAISCGISTIIE.GFAGGLIR
DSQ  ACCAAAAAAGACCTGCTCATCACCATGCTTATATTTGGCCTG...ATTGGAATAGCAGGAACTTACCTAGGAGTCCCCATA------------------------...------------------------AATGACGCAATAGCAAATTCAAGAGTAGTGGGCCCTATGGTGGCAGGGCTTATAGGCGGACCTCTTGTAGGCCTGGGCGCAGGCCTTATAGCAGGTGTACATCGCTTCTTCCTA------GGAGGCTTCACAGCCATCTCCTGTGGAATATCCACCATTATTGAA...GGTTTTGCAGGTGGCCTCATACGA
TRN  10010101100011001
NAM  Q7P590_FUSNV/39-127
ASQ  TKKDIIALSFFFSL.LSISGTYIGLNF--------.--------NGAILNTRNVGVIAGGILGGPYVAIITGLVAGIHRAFVNLGRETAIPCAIATITG.GFLTAYVH
DSQ  ACTAAAAAAGATATAATAGCTCTATCTTTTTTCTTCTCATTA...CTTTCTATAAGTGGAACTTATATAGGATTAAATTTT------------------------...------------------------AATGGTGCTATACTAAATACTAGAAATGTTGGTGTTATAGCAGGAGGTATTTTAGGTGGTCCTTATGTTGCAATAATTACAGGACTTGTAGCAGGAATACATAGAGCCTTTGTTAATCTTGGAAGAGAAACTGCTATACCTTGTGCCATTGCAACAATAACAGGT...GGATTTTTAACTGCTTATGTACAT
TRN  10010101110011000
NAM  Q892V8_CLOTE/37-140
ASQ  KEFNKLALIVFFSL.LSILGTYTGVNIDSMAPASFnKSTLINLNPHAIANTRPIGAITAGYLGGPLVGICVGLIAGLQRYYV--GGFTALACAVATIMG.GICGGLAR
DSQ  AAAGAATTTAATAAACTTGCTTTAATAGTTTTTTTCAGTCTT...CTATCCATATTGGGTACCTACACTGGAGTTAATATAGATTCTATGGCCCCAGCTAGTTTTaatAAATCTACATTAATTAATTTAAATCCCCATGCCATAGCTAATACTCGCCCCATAGGAGCTATAACTGCTGGATATTTAGGTGGCCCTCTGGTTGGTATATGTGTAGGACTTATTGCAGGTTTACAAAGGTATTATGTA------GGGGGCTTTACAGCATTAGCCTGTGCAGTAGCCACAATAATGGGA...GGAATTTGTGGTGGTTTAGCCAGA
TRN  10010101100011010
NAM  Q8EDD8_SHEON/36-122
ASQ  RLPHKIFIYLVFSS.FCIMATYFGEQT--------.--------SGAIANTRAMGAVLGGLLGGPVTGFLVGLTGGLHRYSM--GGFTDLACAISTTLE.GLSAGMIS
DSQ  CGCCTGCCTCACAAGATATTTATTTATCTGGTTTTTTCTAGC...TTTTGTATCATGGCGACCTACTTTGGTGAGCAAACC------------------------...------------------------TCGGGGGCTATTGCCAATACTCGTGCCATGGGCGCCGTATTAGGCGGATTGCTCGGCGGCCCTGTTACAGGTTTTTTGGTGGGGCTCACTGGTGGATTACACCGCTATAGTATG------GGCGGCTTTACCGATTTAGCCTGTGCTATCTCGACAACACTCGAA...GGGCTCTCGGCGGGAATGATCAGT
TRN  10010111100111010
NAM  Q7NXG1_CHRVO/64-150
ASQ  QLPHKLVCYLVFSM.FCIMGTYFGLHI--------.--------QDSIANTRAIGAVLGGMLGGPWVGLAVGFTGGLHRYSL--GGLTAGACMVSTMME.GLLGGLVH
DSQ  CAATTGCCCCACAAGCTGGTCTGTTATCTGGTGTTTTCGATG...TTTTGCATCATGGGCACCTATTTCGGCCTGCACATC------------------------...------------------------CAGGACTCCATCGCCAATACCCGCGCCATCGGCGCGGTGCTGGGCGGCATGCTGGGCGGCCCCTGGGTGGGGCTGGCGGTGGGCTTCACCGGCGGCCTGCACCGCTATTCGCTG------GGCGGGCTCACCGCCGGCGCCTGCATGGTGTCGACGATGATGGAG...GGCCTGCTGGGCGGCCTGGTGCAT
TRN  11011111101111111
NAM  YEHU_ECOLI/39-125
ASQ  RLPHKFLCYIVFSI.FCIMGTWFGLHI--------.--------DDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGLHRYSM--GGMTALSCMISTIVE.GLLGGLVH
DSQ  CGTCTGCCGCATAAATTTCTCTGCTACATCGTCTTTTCCATC...TTCTGCATCATGGGCACCTGGTTTGGGTTGCACATT------------------------...------------------------GACGATTCTATTGCCAATACCCGTGCGATAGGCGCGGTAATGGGCGGCTTACTCGGCGGTCCGGTCGTCGGTGGGCTGGTTGGGCTGACCGGCGGCTTACATCGATATTCGATG------GGGGGCATGACCGCGTTAAGTTGCATGATCTCGACCATCGTTGAA...GGATTACTCGGTGGCCTGGTACAC
TRN  10010101100011010
NAM  Q87S85_VIBPA/36-122
ASQ  RLSHRLICYVLFSG.FCILGTYFGLHI--------.--------NDAIANTRAIGAVMGGLFGGPVVGFAVGLTGGIHRYSL--GGFTDLACAISTTAE.GVIGGLLH
DSQ  CGCCTTAGCCATCGTTTAATTTGCTACGTGCTCTTTTCTGGC...TTTTGTATCCTCGGGACGTACTTTGGCCTGCACATC------------------------...------------------------AATGATGCGATCGCCAACACGCGTGCCATTGGCGCTGTCATGGGCGGGTTGTTCGGCGGGCCAGTAGTCGGTTTTGCTGTCGGCTTAACCGGCGGGATTCATCGTTATTCCCTT------GGTGGCTTTACCGACCTAGCCTGTGCTATTTCAACCACTGCTGAA...GGCGTGATTGGTGGCTTGTTACAT
TRN  11011111101111100
NAM  LYTS_BACSU/37-139
ASQ  GYKGKAILISIFSL.FSIISNYTGIEIQRNMIVNN.DWVFTIDPSGSIANTRILGVEIGGLLGGPFVGAGIGILAGLHRFSL--GGSTALSCAVSSILA.GVLAGLIG
DSQ  GGCTATAAAGGAAAAGCGATTTTAATTTCTATTTTTTCTCTT...TTCAGCATCATCAGCAATTATACAGGCATCGAAATTCAAAGAAATATGATTGTAAACAAT...GACTGGGTGTTTACGATAGATCCATCGGGCTCTATCGCGAATACCCGTATTTTGGGCGTGGAAATCGGGGGCCTTCTCGGAGGTCCTTTTGTAGGGGCTGGGATCGGCATACTTGCGGGCCTGCATCGTTTTTCACTC------GGTGGCAGCACGGCCTTAAGCTGTGCCGTCTCATCTATTTTAGCG...GGTGTTCTTGCAGGCTTGATCGGC
TRN  10010101100011000
NAM  LYTS_BACCR/37-139
ASQ  GYVDKLKLICIFSV.FTIVSNYTGIEIAGNTIMNE.NWLQGVSSSSTIANTRIMGVGISGLLGGPIVGIGVGSIAGIHRYML--GGTTALSCAISSILA.GVITGYIG
DSQ  GGCTATGTAGATAAGCTTAAGCTTATTTGTATTTTTTCGGTA...TTTACAATTGTAAGCAATTACACTGGGATTGAAATAGCAGGAAATACGATTATGAATGAA...AATTGGTTACAAGGTGTTTCATCATCGAGTACCATTGCGAATACACGTATTATGGGTGTTGGAATTAGTGGATTGCTTGGTGGTCCTATCGTCGGAATTGGGGTAGGATCAATTGCTGGTATTCACCGTTATATGCTT------GGAGGGACGACAGCTCTAAGTTGTGCAATCTCGTCAATTTTAGCA...GGTGTTATAACGGGGTATATTGGA
TRN  10010111110111000
NAM  YPDA_ECOLI/41-129
ASQ  SPKELLAVTAIFSL.FALFSTWSGVPV--------.--------EGSLVNVRIIAVMSGGILFGPWVGIITGVIAGIHRYLIDIGGVTAIPCFITSILA.GCISGWIN
DSQ  TCCCCAAAAGAATTGCTCGCCGTTACCGCCATTTTCTCGCTG...TTCGCCCTGTTCAGCACCTGGTCCGGCGTTCCCGTA------------------------...------------------------GAAGGCTCGCTGGTGAACGTACGTATTATCGCGGTGATGTCCGGCGGGATTCTGTTTGGCCCGTGGGTAGGCATCATTACCGGCGTGATTGCGGGTATTCACCGGTATTTAATTGATATCGGCGGCGTGACGGCGATCCCCTGCTTTATCACCAGCATTCTGGCG...GGTTGTATATCGGGCTGGATCAAC
TRN  10010101100011010
NAM  Q8DZT0_STRA5/36-138
ASQ  LKKHQYILLILFSL.FAIISNFTGVEIQSDLSIIP.QTLNHIADQSSVANTRVLTIGVSGLIGGPIVGIIVGLLSVFVRYLQ--GGLAPHIYVISSLLI.GLCSGLSG
DSQ  TTAAAAAAACACCAGTATATTCTGCTTATCTTATTTAGCTTA...TTTGCTATTATTTCTAATTTTACAGGGGTAGAAATTCAGTCAGATTTATCTATCATTCCA...CAAACTCTTAATCATATAGCAGATCAATCATCGGTTGCCAATACACGTGTTTTAACCATTGGTGTATCAGGTCTAATCGGTGGCCCCATAGTCGGTATTATAGTTGGTCTCTTATCTGTATTCGTTAGGTATTTGCAA------GGAGGATTAGCCCCTCATATTTATGTCATTTCTTCCTTACTAATT...GGTTTATGCTCTGGATTATCAGGC
TRN  10010101100011000
NAM  LYTS_STAEP/37-139
ASQ  KWRSKFQLIIIFGI.FSMISNFTGIEIENGHIVSS.DIYYHLSKDASMANTRVLTIGVSGLIGGPWVAIIVGIISGLCRLYI--GGADAYTYLISSIVI.AIISGYFG
DSQ  AAATGGCGTTCAAAATTCCAACTAATCATTATTTTTGGTATA...TTCTCTATGATTTCAAATTTTACAGGAATTGAAATAGAAAATGGCCATATCGTATCTAGT...GATATTTATTACCACTTAAGCAAAGACGCCTCAATGGCCAATACCCGTGTATTAACAATCGGTGTTTCTGGTCTAATAGGTGGACCGTGGGTAGCTATAATTGTAGGCATTATTTCAGGATTATGTCGTTTATATATT------GGCGGGGCTGACGCATATACCTATCTTATTTCATCCATAGTTATC...GCTATCATATCTGGTTACTTTGGT
TRN  10010101110011000
NAM  LYTS_STAAM/37-139
ASQ  TWKARWQLCIIFSL.FALMSNLTGIVIDHQHSLSG.SVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLFVGVISGIFRVYM--GGADAQVYLISSIFI.GIIAGYFG
DSQ  ACATGGAAAGCACGTTGGCAATTATGTATTATTTTCAGTTTG...TTTGCCTTAATGTCTAATTTAACTGGTATCGTCATCGATCATCAACATAGTTTGTCAGGA...AGTGTGTACTTCCGTTTAGATGATGATGTATCTTTAGCTAACACACGTGTATTAACGATAGGTGTCGCAGGATTAGTTGGTGGCCCTTTTGTAGGTCTATTTGTTGGCGTTATTTCAGGTATTTTCAGAGTGTATATG------GGTGGGGCGGATGCACAAGTTTATCTTATCTCATCTATATTTATC...GGTATAATTGCTGGTTATTTTGGC
TRN  10010101110011000
NAM  LYTS_STRMU/34-137
ASQ  SKREKLVLIIIFGI.FVIISNMTGIEITSDKSLVErPILTTISHSDSLANTRTLVITTASLVGGPLVGTVVGFIGGVHRFFQ--GNFSGAFYIVSSALV.GYISGRLG
DSQ  TCTAAGCGTGAAAAGCTGGTTCTTATTATCATTTTTGGTATT...TTCGTCATCATTTCCAATATGACAGGAATTGAAATCACTAGCGATAAAAGTTTGGTGGAAcgtCCTATTCTAACGACTATTTCTCATTCAGATTCTCTAGCTAATACGAGAACTTTGGTTATCACAACGGCTAGCTTAGTCGGCGGTCCTTTAGTTGGAACTGTTGTGGGTTTCATTGGTGGTGTCCATCGTTTCTTTCAA------GGGAATTTTTCTGGTGCTTTTTACATTGTCAGTTCTGCTTTGGTA...GGATATATTAGTGGTCGACTGGGT
TRN  10010101100011000
NAM  LYTS_ENTFA/37-139
ASQ  KMSSKVQLILIFGL.FAIISNFTGIEIAKNQIVPN.NLLTYLSSNASIANTRTLVIGVSGLVGGPIVGSAVGLIAGFHRVIQ--GGGHSFFYVPASLIV.GLIAGFLG
DSQ  AAAATGTCTTCAAAAGTTCAGTTGATTTTGATTTTTGGTTTA...TTTGCTATTATTTCTAATTTTACAGGTATCGAAATCGCTAAGAATCAGATTGTTCCCAAT...AATTTACTAACCTATTTAAGCAGCAATGCTTCCATTGCGAATACGCGTACGTTAGTAATTGGCGTTTCTGGATTAGTGGGTGGTCCGATTGTCGGCAGTGCGGTTGGTTTAATTGCTGGCTTTCATCGGGTTATTCAA------GGCGGGGGGCATAGTTTCTTTTATGTGCCTGCTTCTTTAATTGTT...GGCTTAATTGCCGGTTTTTTAGGG
TRN  11011101111011000
NAM  LYTS_OCEIH/37-139
ASQ  TLKTVIYHSLIFGL.ISIIGAHVGVVMIGNELIMQ.AWIINVAENEVLIGFSIVVVMIAGLLGGPFLGLGTGMVAGLYIIFL--GGGGWVANSLINPLA.GLLTGWAG
DSQ  ACGTTAAAAACAGTTATCTATCATTCTCTTATATTTGGATTA...ATAAGTATTATTGGAGCACATGTTGGAGTTGTTATGATAGGTAATGAGTTAATCATGCAA...GCTTGGATTATAAATGTTGCAGAAAATGAAGTCTTAATAGGGTTTAGTATCGTTGTTGTGATGATTGCCGGACTACTTGGCGGACCATTTTTAGGATTAGGCACAGGAATGGTTGCCGGCTTATATATCATTTTTTTA------GGTGGCGGAGGATGGGTTGCAAATAGTTTGATTAATCCTTTAGCT...GGCTTATTAACTGGATGGGCTGGT
TRN  10010101110011010
NAM  Q97DD4_CLOAB/29-121
ASQ  DKVRTIWGKVIVGV.FCGFAGILLLMYSKH-----.-----IKNTDTLIDLRAYAVMIASYTAGTLPTIISGIMIMLYRVFHFGVSVSSIVAAFRIL--.SYIIFFYI
DSQ  GATAAGGTTAGAACTATTTGGGGAAAGGTTATTGTAGGTGTT...TTCTGTGGATTTGCAGGAATCTTGTTATTAATGTATTCAAAGCAT---------------...---------------ATTAAGAACACAGATACATTAATAGATCTTAGAGCTTATGCTGTAATGATAGCTTCTTATACTGCTGGAACATTGCCGACAATAATCTCTGGAATTATGATTATGCTATATCGTGTATTTCATTTTGGAGTAAGTGTATCATCTATTGTAGCCGCTTTTCGAATTTTA------...TCATATATAATATTTTTCTATATA
TRN  10010101110011000
NAM  Q99VM8_STAAN/30-116
ASQ  MVFSKAYVTVLMTI.VSLLLSVYPIPY--------.-------REDYLIHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVV---FNNSIMYGVTLIVI.AAVTSAIG
DSQ  ATGGTTTTTTCTAAGGCTTATGTCACTGTTTTAATGACAATC...GTATCATTATTATTATCTGTCTACCCTATCCCTTAT------------------------...---------------------CGTGAAGATTATTTAATTCACTTAACATTCGTTCCTTTATTGTTTTTAGGTAGATTTACAAATATGGTCTATACATTATCTGCCACAGTAATTGTAGCAATTGTTGAAATTGTAGTA---------TTTAACAACTCGATTATGTACGGTGTTACGTTGATTGTTATT...GCTGCAGTAACAAGTGCTATTGGA
TRN  10110101110011000
NAM  Q8CTF5_STAEP/30-117
ASQ  MIFSKEYVTVLMTF.VSLLLAAYPIPF--------.-------QNEYLVHLTFVPLLFLGRYTNMIYTLTAAFIVSLVDVFI---FGNSIIYGITLIVIaGIVSAVGP
DSQ  ATGATTTTTTCTAAAGAATATGTAACAGTACTAATGACATTC...GTTTCTTTACTTTTAGCGGCATACCCTATCCCATTT------------------------...---------------------CAAAACGAATACCTCGTCCATTTAACATTTGTACCTCTTTTGTTTTTAGGACGTTATACCAACATGATATATACACTCACGGCTGCTTTTATCGTATCTTTAGTCGATGTATTTATC---------TTTGGAAACTCAATTATTTATGGTATTACATTAATCGTTATTgcaGGTATTGTCAGTGCAGTGGGACCA
TRN  10010101110011000
//