EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07640 - QPP)
FAM  PF07640
PID  QPP
DES  QPP
IPR  IPR011507
ANO  7
ALN  36
AID  0.462221
APH  (((((Q7UWC5_RHOBA/27-62:0.82349,Q7UIX9_RHOBA/1-36:0.37681):0.09614,Q7UV46_RHOBA/1-36:0.55012):0.12250,Q7UWC0_RHOBA/14-49:0.25385):0.25204,Q7USN9_RHOBA/1-36:0.44820):0.29770,Q7UVN7_RHOBA/1-36:0.20665,Q7UKS6_RHOBA/1-36:0.51386);
ATP  (((((Q7UWC5_RHOBA/27-62,Q7UIX9_RHOBA/1-36),Q7UV46_RHOBA/1-36),Q7UWC0_RHOBA/14-49),Q7USN9_RHOBA/1-36),Q7UVN7_RHOBA/1-36,Q7UKS6_RHOBA/1-36);
ATL  3.95357
DNO  2
DLN  108
DID  0.555556
DPH  (Q7UWC5_RHOBA/27-62:0.68900,Q7UWC0_RHOBA/14-49:0.00000);
DTP  (Q7UWC5_RHOBA/27-62,Q7UWC0_RHOBA/14-49);
DTL  0.689
RID  0.393939
RPH  (Q7UWC5_RHOBA/27-62:1.08102,Q7UWC0_RHOBA/14-49:0.07741);
RTP  (Q7UWC5_RHOBA/27-62,Q7UWC0_RHOBA/14-49);
RTL  1.15844
LNK  Q7UIX9_RHOBA/1-36:Q7UIX9:
LNK  Q7UKS6_RHOBA/1-36:Q7UKS6:
LNK  Q7USN9_RHOBA/1-36:Q7USN9:
LNK  Q7UV46_RHOBA/1-36:Q7UV46:
LNK  Q7UVN7_RHOBA/1-36:Q7UVN7:
LNK  Q7UWC0_RHOBA/14-49:Q7UWC0:BX294136
LNK  Q7UWC5_RHOBA/27-62:Q7UWC5:BX294136
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q7UWC5_RHOBA/27-62
ASQ  LASDQPPLTRYGSFNQQPANAKTADWMHCPAWQIQS
DSQ  TTGGCGTCTGATCAACCGCCGCTGACGCGGTACGGCTCATTCAATCAACAACCCGCGAACGCCAAAACGGCTGATTGGATGCATTGCCCAGCTTGGCAAATCCAATCC
TRN  11011101101011001
NAM  Q7UWC0_RHOBA/14-49
ASQ  MASNQPPLTRCGSMNRQPVSSGWKSRETYHLWSLPR
DSQ  ATGGCGTCGAATCAACCGCCGCTAACGCGGTGCGGCTCAATGAATCGACAGCCTGTTAGCTCGGGGTGGAAGTCCCGTGAGACCTACCATCTTTGGTCTCTACCGAGA
TRN  10010101110011001
NAM  Q7UIX9_RHOBA/1-36
ASQ  MASNQPPLTRCGSINQQPVSPGSHGTNPSRPPSEQN
NAM  Q7USN9_RHOBA/1-36
ASQ  MASNQPPLKRCGSINQQPVRRPDCVLRNHRLEAFAT
NAM  Q7UV46_RHOBA/1-36
ASQ  MASSQPPRTRCGSINQQPVSRFLRTFRIALNWATNR
NAM  Q7UKS6_RHOBA/1-36
ASQ  MASDQPPLTRFGSFNQQSPRAQVPPQGSQYLPKDSP
NAM  Q7UVN7_RHOBA/1-36
ASQ  MAPNQPPLTRCGSINQQSGRRQRPLRRPQHQPYQPP
//