EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07624 - PSD2)
FAM  PF07624
PID  PSD2
DES  Protein of unknown function (DUF1585)
IPR  IPR011478
ANO  15
ALN  77
AID  0.291512
APH  ((((Q7UQ19_RHOBA/635-710:0.62766,Q7UQA7_RHOBA/821-895:1.35310):0.20518,((Q7UGA7_RHOBA/786-861:0.76419,((((Q7UPJ6_RHOBA/750-825:0.93179,Q7UYT2_RHOBA/756-831:0.38147):0.27125,Q7UIH1_RHOBA/765-841:0.58763):0.16172,Q7UJH8_RHOBA/855-931:0.46853):0.05223,Q7UH44_RHOBA/772-847:0.88555):0.13964):0.11978,(Q7UPC3_RHOBA/710-786:0.45991,(Q7UYH7_RHOBA/1250-1325:0.67611,Q7UKQ6_RHOBA/764-839:0.52319):0.19036):0.09549):0.07644):0.24048,(Q7UUL3_RHOBA/879-955:0.83715,Q7UVA3_RHOBA/763-838:0.63675):0.20259):0.14092,Q7UGR4_RHOBA/564-639:0.63688,Q7UJA2_RHOBA/950-1026:0.52678);
ATP  ((((Q7UQ19_RHOBA/635-710,Q7UQA7_RHOBA/821-895),((Q7UGA7_RHOBA/786-861,((((Q7UPJ6_RHOBA/750-825,Q7UYT2_RHOBA/756-831),Q7UIH1_RHOBA/765-841),Q7UJH8_RHOBA/855-931),Q7UH44_RHOBA/772-847)),(Q7UPC3_RHOBA/710-786,(Q7UYH7_RHOBA/1250-1325,Q7UKQ6_RHOBA/764-839)))),(Q7UUL3_RHOBA/879-955,Q7UVA3_RHOBA/763-838)),Q7UGR4_RHOBA/564-639,Q7UJA2_RHOBA/950-1026);
ATL  12.3239
DNO  15
DLN  231
DID  0.43187
DPH  ((((Q7UQ19_RHOBA/635-710:0.36594,Q7UQA7_RHOBA/821-895:0.73250):0.10251,(((Q7UGA7_RHOBA/786-861:0.43424,(Q7UYH7_RHOBA/1250-1325:0.44611,Q7UKQ6_RHOBA/764-839:0.38255):0.06626):0.06770,((Q7UGR4_RHOBA/564-639:0.47849,Q7UJA2_RHOBA/950-1026:0.37881):0.16443,(Q7UJH8_RHOBA/855-931:0.41094,(Q7UIH1_RHOBA/765-841:0.23497,Q7UYT2_RHOBA/756-831:0.61905):0.20386):0.06635):0.07371):0.10287,Q7UPC3_RHOBA/710-786:0.30546):0.12576):0.08753,(Q7UPJ6_RHOBA/750-825:0.53199,Q7UUL3_RHOBA/879-955:0.55678):0.07033):0.20023,Q7UH44_RHOBA/772-847:0.41839,Q7UVA3_RHOBA/763-838:0.51061);
DTP  ((((Q7UQ19_RHOBA/635-710,Q7UQA7_RHOBA/821-895),(((Q7UGA7_RHOBA/786-861,(Q7UYH7_RHOBA/1250-1325,Q7UKQ6_RHOBA/764-839)),((Q7UGR4_RHOBA/564-639,Q7UJA2_RHOBA/950-1026),(Q7UJH8_RHOBA/855-931,(Q7UIH1_RHOBA/765-841,Q7UYT2_RHOBA/756-831)))),Q7UPC3_RHOBA/710-786)),(Q7UPJ6_RHOBA/750-825,Q7UUL3_RHOBA/879-955)),Q7UH44_RHOBA/772-847,Q7UVA3_RHOBA/763-838);
DTL  8.13837
RID  0.291512
RPH  ((((Q7UQ19_RHOBA/635-710:0.62766,Q7UQA7_RHOBA/821-895:1.35310):0.20518,((Q7UGA7_RHOBA/786-861:0.76419,((((Q7UPJ6_RHOBA/750-825:0.93179,Q7UYT2_RHOBA/756-831:0.38147):0.27125,Q7UIH1_RHOBA/765-841:0.58763):0.16172,Q7UJH8_RHOBA/855-931:0.46853):0.05223,Q7UH44_RHOBA/772-847:0.88555):0.13964):0.11978,(Q7UPC3_RHOBA/710-786:0.45991,(Q7UYH7_RHOBA/1250-1325:0.67611,Q7UKQ6_RHOBA/764-839:0.52319):0.19036):0.09549):0.07644):0.24048,(Q7UUL3_RHOBA/879-955:0.83715,Q7UVA3_RHOBA/763-838:0.63675):0.20259):0.14092,Q7UGR4_RHOBA/564-639:0.63688,Q7UJA2_RHOBA/950-1026:0.52678);
RTP  ((((Q7UQ19_RHOBA/635-710,Q7UQA7_RHOBA/821-895),((Q7UGA7_RHOBA/786-861,((((Q7UPJ6_RHOBA/750-825,Q7UYT2_RHOBA/756-831),Q7UIH1_RHOBA/765-841),Q7UJH8_RHOBA/855-931),Q7UH44_RHOBA/772-847)),(Q7UPC3_RHOBA/710-786,(Q7UYH7_RHOBA/1250-1325,Q7UKQ6_RHOBA/764-839)))),(Q7UUL3_RHOBA/879-955,Q7UVA3_RHOBA/763-838)),Q7UGR4_RHOBA/564-639,Q7UJA2_RHOBA/950-1026);
RTL  12.3239
LNK  Q7UGA7_RHOBA/786-861:Q7UGA7:BX294147
LNK  Q7UGR4_RHOBA/564-639:Q7UGR4:BX294141
LNK  Q7UH44_RHOBA/772-847:Q7UH44:BX294141
LNK  Q7UIH1_RHOBA/765-841:Q7UIH1:BX294155
LNK  Q7UJA2_RHOBA/950-1026:Q7UJA2:BX294154
LNK  Q7UJH8_RHOBA/855-931:Q7UJH8:BX294154
LNK  Q7UKQ6_RHOBA/764-839:Q7UKQ6:BX294150
LNK  Q7UPC3_RHOBA/710-786:Q7UPC3:BX294145
LNK  Q7UPJ6_RHOBA/750-825:Q7UPJ6:BX294145
LNK  Q7UQ19_RHOBA/635-710:Q7UQ19:BX294144
LNK  Q7UQA7_RHOBA/821-895:Q7UQA7:BX294144
LNK  Q7UUL3_RHOBA/879-955:Q7UUL3:BX294138
LNK  Q7UVA3_RHOBA/763-838:Q7UVA3:BX294137
LNK  Q7UYH7_RHOBA/1250-1325:Q7UYH7:BX294134
LNK  Q7UYT2_RHOBA/756-831:Q7UYT2:BX294133
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q7UQA7_RHOBA/821-895
ASQ  AKPQPYETPADLMKLLST--SDRVRETLTWKVTQFAMGRPLGARDVTEVERIHQAATGAGGRYADVVTAVVMSDLVQ
DSQ  GCAAAGCCGCAGCCCTACGAGACGCCCGCTGATTTGATGAAGCTGCTGTCGACA------AGCGATCGTGTTCGCGAAACTTTGACTTGGAAAGTAACGCAGTTCGCGATGGGCCGACCTTTAGGTGCCCGTGATGTAACCGAGGTGGAGCGGATTCATCAGGCTGCCACGGGTGCGGGCGGTCGTTACGCCGATGTGGTCACCGCGGTGGTGATGAGCGATCTGGTGCAG
TRN  11011101101011010
NAM  Q7UYT2_RHOBA/756-831
ASQ  PSGESFEGFDAFRDCLLK-DPDQLAMSLITKWLTFATGREMGFSDRQEIESLTRQSAQRGHGLRTMLALVIASDIFR
DSQ  CCATCGGGCGAATCCTTCGAAGGATTTGACGCATTTCGGGATTGCCTTCTCAAA---GACCCTGATCAATTGGCAATGTCATTGATCACCAAGTGGCTGACGTTTGCCACGGGGCGAGAAATGGGGTTTTCCGATCGGCAAGAAATTGAATCTTTAACGCGGCAATCCGCTCAGCGAGGTCATGGGCTTCGCACGATGTTGGCGTTGGTCATCGCCAGCGACATTTTCCGA
TRN  11011101101011000
NAM  Q7UIH1_RHOBA/765-841
ASQ  PSGEEFTNFGDFKQKLLESRREQFTRSLIEKLLAYSTGRHMERADQFEIDDILVRVQADNNGLRTMVTDVLTSSLFR
DSQ  CCATCGGGCGAAGAGTTTACGAATTTCGGCGATTTCAAGCAGAAGCTACTGGAAAGCCGTCGCGAACAGTTCACTCGGAGTCTGATCGAAAAGCTGCTGGCTTATTCGACAGGCCGGCACATGGAGCGTGCTGATCAATTTGAGATCGATGACATTTTGGTACGCGTCCAAGCTGACAACAACGGGTTGCGGACGATGGTAACAGATGTCCTCACCAGCAGTCTGTTCCGG
TRN  11011111101111111
NAM  Q7UQ19_RHOBA/635-710
ASQ  FRKHRFENVIEFKDALLV-EKDRFTEALAGHLLSFALARPLSAADRVALDEITAKVAADEYKIHTLLRQVVLSEPFQ
DSQ  TTTCGCAAGCACCGTTTTGAGAACGTGATCGAATTCAAGGACGCGTTGCTGGTG---GAAAAGGATCGATTCACCGAGGCGTTGGCGGGGCATCTGCTGAGTTTCGCGTTGGCTCGTCCGCTGAGTGCCGCCGATCGTGTTGCGCTGGATGAGATCACGGCGAAGGTTGCCGCGGACGAATACAAAATTCACACGCTGCTTCGCCAAGTTGTGTTGAGCGAACCGTTTCAA
TRN  11011101101011011
NAM  Q7UJH8_RHOBA/855-931
ASQ  FNQQELAGVEGLKRYLLEHRQDQFVRGMVHKLATYALGRPLTFSDHSSIDEITAEVRQRGDGLATMIEQLVTSDLFQ
DSQ  TTCAATCAACAAGAACTTGCCGGCGTCGAAGGTCTCAAACGATACCTGCTGGAACATCGCCAGGATCAATTTGTCCGTGGGATGGTCCATAAACTGGCAACTTACGCGTTGGGGCGTCCGCTCACATTTTCGGACCACTCCAGCATCGACGAAATCACCGCCGAAGTCCGCCAACGCGGCGATGGCCTCGCGACGATGATCGAGCAATTGGTCACCAGCGACCTGTTTCAA
TRN  11011101101011011
NAM  Q7UJA2_RHOBA/950-1026
ASQ  PDGGQGDGIEGLKDYIRRDREKDFVEHLCRKLLAFALGRSLQLSDESLIAEMQSNLEANEYRFQSMIETIVTSPAFR
DSQ  CCCGATGGCGGCCAGGGCGACGGCATCGAGGGCCTGAAAGATTACATTCGCCGCGACCGTGAGAAGGACTTCGTCGAACATCTGTGTCGCAAGCTTTTAGCCTTCGCACTAGGACGTTCCTTGCAGCTATCAGATGAATCCTTGATCGCTGAGATGCAGTCCAACTTAGAAGCCAATGAATACCGTTTTCAATCCATGATCGAAACGATCGTGACCAGCCCCGCGTTTCGC
TRN  11011101101011000
NAM  Q7UGR4_RHOBA/564-639
ASQ  PSGETFSGPEELKQLLLR-RSGEFKKHFVKKLYGFALGRSLNKFDNCVVDESLEALDNNEQRATVILETIVTSYPFR
DSQ  CCTTCAGGGGAAACGTTCTCCGGCCCCGAAGAGCTGAAACAATTGTTGTTACGA---CGAAGCGGTGAATTCAAGAAGCACTTCGTCAAGAAACTGTACGGCTTCGCTCTGGGCCGGTCGCTCAATAAGTTTGACAATTGTGTCGTCGATGAATCGTTGGAAGCGTTGGATAACAATGAGCAACGCGCCACAGTGATCCTGGAAACCATCGTGACCAGTTATCCATTTCGC
TRN  11011101101011000
NAM  Q7UKQ6_RHOBA/764-839
ASQ  PGGAKFDGPEGLKQQLVK-RKDFIARTVTERLLTHALGRRMEPTDRAAVDAILMPLKGEDYPTAQLIESIVTSELFR
DSQ  CCCGGTGGTGCCAAGTTTGATGGACCCGAGGGATTGAAGCAGCAACTGGTCAAG---CGGAAGGATTTCATCGCTCGGACGGTTACCGAGCGGTTGCTAACGCATGCACTCGGACGACGAATGGAACCAACTGACCGTGCAGCGGTGGATGCGATCCTGATGCCGCTCAAGGGGGAGGACTACCCGACCGCTCAGTTGATTGAGTCCATCGTGACCAGCGAACTTTTTCGT
TRN  11011111101111111
NAM  Q7UYH7_RHOBA/1250-1325
ASQ  PDGTELQSVDELEAGIVA-RPDIFAQTVAEKLMTYALGRAVEPHDGPAIRRIVRGASQSNYTLASLINGIVLSEPFR
DSQ  CCCGATGGCACCGAGTTGCAGTCGGTCGATGAACTGGAAGCCGGCATCGTGGCG---CGACCGGACATCTTCGCTCAAACCGTTGCCGAAAAACTGATGACCTACGCACTTGGGCGAGCCGTCGAGCCACACGACGGACCGGCAATTCGCCGCATCGTTCGCGGTGCGTCGCAGTCCAACTACACGCTGGCTTCTCTGATCAATGGCATCGTTCTGAGCGAGCCGTTTCGG
TRN  11011101101011011
NAM  Q7UPC3_RHOBA/710-786
ASQ  PDGTSFDGINGLRDLLTSQRSEQFVRCLAEKMLIYALGRGTEYYDKCAMDKITADVRAHDYKFAYLIAAIIQSDPFQ
DSQ  CCCGACGGGACCTCGTTTGACGGTATCAATGGACTGCGAGATTTGTTGACGTCGCAGCGAAGCGAGCAGTTTGTTCGATGTTTGGCTGAGAAGATGTTGATCTACGCGTTGGGGCGTGGGACGGAATATTATGACAAGTGTGCAATGGATAAAATCACGGCTGATGTTCGTGCGCACGATTACAAATTCGCTTACTTGATCGCTGCGATCATCCAGAGCGATCCATTTCAG
TRN  11011101101011011
NAM  Q7UVA3_RHOBA/763-838
ASQ  PSGETFEGVDELRAVLMA-RQDAFLDEYIRRMLGFALARSLEEADACTIDSIRNQMLQNDLQTRELIHAIIQSTPFL
DSQ  CCCAGCGGAGAAACATTCGAGGGCGTTGATGAACTAAGAGCTGTCCTGATGGCT---CGCCAAGACGCTTTCCTCGACGAATACATCCGACGCATGCTTGGCTTCGCCCTAGCGAGAAGTTTGGAAGAAGCCGACGCGTGCACGATCGACTCGATCCGAAATCAGATGTTGCAAAACGACTTGCAAACTCGCGAGTTGATTCATGCCATCATTCAAAGCACTCCATTTTTA
TRN  10010101100011010
NAM  Q7UUL3_RHOBA/879-955
ASQ  PGGRSFRGAMELSEMLASTETRRFADTTVRRLLSFAIGRELRPADRCFVEAILDDAEDEGFRLRDLVEGVINSPPFL
DSQ  CCAGGCGGTCGTTCGTTCCGCGGAGCGATGGAATTGAGTGAAATGTTGGCAAGCACCGAAACGCGGCGTTTTGCTGACACGACCGTCCGTCGATTGTTATCCTTTGCTATCGGCCGCGAATTGCGTCCTGCCGATCGATGTTTTGTAGAAGCCATTTTGGATGACGCTGAAGATGAAGGTTTCCGTTTGCGAGACCTCGTCGAAGGCGTCATCAACAGCCCACCGTTTTTG
TRN  11011111111111110
NAM  Q7UGA7_RHOBA/786-861
ASQ  PNGNEFTGFEDFRGLLLQ-QSDRFRRALAEKVFVYAFGRPVGPEDDAPLTRVVTDMKAEGDTFRALIQSIVTSQAFV
DSQ  CCCAACGGCAACGAATTCACAGGCTTCGAAGATTTCCGGGGGTTGCTGCTGCAG---CAGAGCGATCGCTTCCGCCGAGCCTTGGCGGAAAAGGTGTTTGTCTACGCATTTGGCCGCCCCGTTGGACCGGAGGACGACGCCCCCCTGACTCGCGTCGTCACCGACATGAAAGCGGAAGGCGACACCTTCCGTGCACTGATTCAATCCATTGTCACCAGCCAGGCATTTGTG
TRN  11011101101011011
NAM  Q7UH44_RHOBA/772-847
ASQ  PIGQSFANFFELRDAVAQ-HKDAFVRGFTEALIAYGLGRPFGFTDQELANQISSQAKQHNHSIRQFIHALVQSPEFQ
DSQ  CCAATCGGACAATCGTTCGCGAACTTCTTTGAATTGCGGGACGCGGTTGCACAG---CACAAAGACGCATTCGTTCGCGGGTTCACGGAGGCCTTGATCGCATACGGTCTCGGCCGTCCGTTCGGGTTCACCGATCAGGAACTCGCGAACCAAATCAGCTCTCAAGCAAAGCAGCACAACCATTCGATCCGCCAGTTCATTCACGCACTGGTTCAGTCCCCCGAATTTCAA
TRN  11011101101011011
NAM  Q7UPJ6_RHOBA/750-825
ASQ  PEGSTFDSFVTFRNLIAK-KDERLAANVASHFVTYATGQTIQFADRDRIEKIVSNSRDNQFGFRSLLDEVIRSDLFL
DSQ  CCCGAAGGGTCAACGTTTGACTCCTTCGTTACTTTTCGAAACCTGATCGCGAAG---AAGGACGAACGATTGGCCGCGAACGTTGCGTCGCACTTTGTCACTTACGCTACCGGCCAAACCATCCAGTTTGCTGATCGCGATCGAATCGAAAAGATTGTCTCGAATTCGAGAGACAACCAATTCGGCTTTCGGTCGCTTTTAGATGAAGTCATCCGAAGCGATTTGTTTCTT
TRN  10010101100011000
//