EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07609 - DUF1572)
FAM  PF07609
PID  DUF1572
DES  Protein of unknown function (DUF1572)
IPR  IPR011466
ANO  4
ALN  39
AID  0.728634
APH  ((Q8CV42_OCEIH/43-81:0.21291,Q81CU9_BACCR/44-82:0.16802):0.04493,Q81ED3_BACCR/43-81:0.08861,Q7UW06_RHOBA/43-81:0.24263);
ATP  ((Q8CV42_OCEIH/43-81,Q81CU9_BACCR/44-82),Q81ED3_BACCR/43-81,Q7UW06_RHOBA/43-81);
ATL  0.7571
DNO  4
DLN  117
DID  0.669516
DPH  ((Q8CV42_OCEIH/43-81:0.20053,Q81ED3_BACCR/43-81:0.17864):0.05875,Q81CU9_BACCR/44-82:0.10100,Q7UW06_RHOBA/43-81:0.41286);
DTP  ((Q8CV42_OCEIH/43-81,Q81ED3_BACCR/43-81),Q81CU9_BACCR/44-82,Q7UW06_RHOBA/43-81);
DTL  0.95178
RID  0.728634
RPH  ((Q8CV42_OCEIH/43-81:0.21291,Q81CU9_BACCR/44-82:0.16802):0.04493,Q81ED3_BACCR/43-81:0.08861,Q7UW06_RHOBA/43-81:0.24263);
RTP  ((Q8CV42_OCEIH/43-81,Q81CU9_BACCR/44-82),Q81ED3_BACCR/43-81,Q7UW06_RHOBA/43-81);
RTL  0.7571
LNK  Q7UW06_RHOBA/43-81:Q7UW06:BX294137
LNK  Q81CU9_BACCR/44-82:Q81CU9:AE017006
LNK  Q81ED3_BACCR/43-81:Q81ED3:AE017004
LNK  Q8CV42_OCEIH/43-81:Q8CV42:BA000028
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8CV42_OCEIH/43-81
ASQ  NSVAVIVKHLSGNMVSRWSDFLTSDGEKSYRNRDQEFEN
DSQ  AATAGTGTTGCAGTTATTGTTAAACATTTAAGTGGAAATATGGTATCTAGATGGTCTGATTTTTTAACTTCAGATGGAGAAAAATCTTATAGGAATCGCGATCAAGAATTTGAGAAT
TRN  10110101110011000
NAM  Q7UW06_RHOBA/43-81
ASQ  NSVAIILRHLGGNLRSRWTDFLTTDGEKPDRNRDAEFVD
DSQ  AATTCTGTCGCGATCATCCTACGTCACCTCGGCGGCAATCTTCGAAGTCGCTGGACTGACTTCCTGACGACGGACGGCGAAAAACCTGACCGGAACCGTGATGCCGAATTCGTTGAT
TRN  11011101101011011
NAM  Q81ED3_BACCR/43-81
ASQ  NSIAIIIKHLHGNMRSRWTDFLTSDGEKTDRNRDGEFEG
DSQ  AATAGTATAGCGATTATTATTAAGCATCTGCACGGTAATATGCGTTCTAGATGGACGGATTTTTTAACGTCTGATGGTGAAAAAACAGATCGTAATCGAGATGGTGAATTTGAAGGA
TRN  10010101100011010
NAM  Q81CU9_BACCR/44-82
ASQ  NSIAIIIKHLSGNMHSRWTNFLTTDGEKEYRDRDGEFLD
DSQ  AATAGTATTGCAATCATTATAAAACATCTGAGTGGAAATATGCATTCAAGGTGGACTAATTTCTTAACAACAGATGGCGAAAAAGAATATAGGGATCGTGATGGTGAATTTCTCGAT
TRN  10010101100011000
//