EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07606 - DUF1569)
FAM  PF07606
PID  DUF1569
DES  Protein of unknown function (DUF1569)
IPR  IPR011463
ANO  4
ALN  156
AID  0.365589
APH  (Q7UJY4_RHOBA/1-151:0.17444,Q7UEB2_RHOBA/1-151:0.20958,(Q7UJR0_RHOBA/85-235:1.02979,Q7UH50_RHOBA/56-206:0.72359):0.52434);
ATP  (Q7UJY4_RHOBA/1-151,Q7UEB2_RHOBA/1-151,(Q7UJR0_RHOBA/85-235,Q7UH50_RHOBA/56-206));
ATL  2.66174
DNO  4
DLN  468
DID  0.461914
DPH  (Q7UJY4_RHOBA/1-151:0.22485,Q7UEB2_RHOBA/1-151:0.23038,(Q7UJR0_RHOBA/85-235:0.74192,Q7UH50_RHOBA/56-206:0.43054):0.36174);
DTP  (Q7UJY4_RHOBA/1-151,Q7UEB2_RHOBA/1-151,(Q7UJR0_RHOBA/85-235,Q7UH50_RHOBA/56-206));
DTL  1.98943
RID  0.365589
RPH  (Q7UJY4_RHOBA/1-151:0.17444,Q7UEB2_RHOBA/1-151:0.20958,(Q7UJR0_RHOBA/85-235:1.02979,Q7UH50_RHOBA/56-206:0.72359):0.52434);
RTP  (Q7UJY4_RHOBA/1-151,Q7UEB2_RHOBA/1-151,(Q7UJR0_RHOBA/85-235,Q7UH50_RHOBA/56-206));
RTL  2.66174
LNK  Q7UEB2_RHOBA/1-151:Q7UEB2:BX294153
LNK  Q7UH50_RHOBA/56-206:Q7UH50:BX294141
LNK  Q7UJR0_RHOBA/85-235:Q7UJR0:BX294152
LNK  Q7UJY4_RHOBA/1-151:Q7UJY4:BX294152
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q7UJY4_RHOBA/1-151
ASQ  MSDLRSLQFENLDDAVLEAQSLLRTGYHPQGNWSLGQICRHLTLVQNPSVDGYPAWMSLFAFLRPAMRRFLLPKLRRP--DSPRGIRTSSMFVP--PEDIDDAEEVDTFARSVDRFRAHSGEYAPH-PAFGRMSRSEIEEIHTWHAAHHLRFLTPN
DSQ  ATGTCAGACCTCAGATCATTGCAGTTCGAGAATTTAGACGATGCGGTTCTTGAAGCTCAATCGCTTCTACGCACTGGTTACCATCCCCAGGGCAACTGGTCGCTCGGACAGATCTGCCGACATCTCACGCTGGTCCAAAACCCGAGCGTCGATGGCTACCCCGCCTGGATGTCATTGTTCGCGTTTTTGCGTCCGGCGATGAGACGATTCCTGCTTCCCAAGCTTCGGCGTCCC------GACTCACCTCGCGGAATTCGAACGTCATCGATGTTTGTCCCG------CCTGAGGACATTGATGATGCGGAAGAGGTCGACACTTTCGCTCGCAGCGTCGATCGATTCCGAGCCCACTCGGGCGAATACGCACCGCAC---CCGGCATTTGGAAGGATGAGCCGAAGCGAGATCGAAGAGATTCACACTTGGCATGCCGCCCATCACTTGCGGTTCCTAACGCCGAAT
TRN  10010101100011000
NAM  Q7UEB2_RHOBA/1-151
ASQ  MEQLRELHFDDLNAAVREARSLLQSGYNRNGNWSLGQICRHLVLVQDPSVDGYPKWMSLFAFLRPVMRRILLPKVLSG--DSPRGIRTASMFVP--PADLDDAREVEAFSASVTRFYAHLGDYAPH-PAFGRLPRERIEQIHSAHAAHHLRFLAPR
DSQ  ATGGAACAACTGCGGGAACTACACTTCGACGATCTGAACGCGGCGGTCCGAGAGGCGCGGTCGCTACTGCAGAGCGGATACAACCGGAATGGCAATTGGTCGCTGGGGCAGATTTGCCGCCATCTGGTACTGGTGCAAGATCCGAGTGTTGATGGCTATCCGAAGTGGATGTCTCTGTTCGCGTTCTTGCGTCCTGTGATGCGACGAATCCTCTTGCCGAAAGTTCTTAGCGGC------GATTCACCGCGTGGAATTCGCACAGCGTCGATGTTCGTTCCG------CCGGCCGATCTGGATGACGCTCGTGAGGTTGAGGCTTTCTCTGCGAGCGTGACTCGGTTCTACGCTCACCTTGGTGACTATGCTCCGCAT---CCAGCGTTTGGGCGATTGCCACGTGAGCGGATTGAGCAAATTCATTCTGCACATGCCGCTCACCACTTGCGTTTCCTTGCACCCCGC
TRN  11011101101011001
NAM  Q7UH50_RHOBA/56-206
ASQ  ATRRMDLRYPDLGAACTDIARLREGGYELVGTWSLAQILDHLNLSMQMTIDGAD--FTFPALMRPVMKWMFMPTMRKGKPSKLRG-KAPEQLQP--AMDLDEDACAKRFYSLAETLMDPSTPFVSHYPMLGRLTREQWLLMQQWHAAHHLSFVVPN
DSQ  GCCACACGACGCATGGATCTTCGTTACCCCGACCTGGGCGCCGCGTGTACCGACATCGCTCGCTTGCGTGAAGGAGGCTACGAACTCGTTGGCACTTGGAGCCTGGCGCAGATACTCGATCATCTGAACTTGTCGATGCAGATGACGATTGACGGTGCCGAC------TTCACGTTCCCGGCATTGATGCGGCCGGTGATGAAATGGATGTTCATGCCGACGATGCGGAAAGGCAAACCATCCAAGCTACGTGGG---AAGGCGCCGGAGCAGCTTCAACCA------GCGATGGACCTCGATGAAGACGCGTGTGCGAAACGGTTCTACTCGCTCGCGGAGACACTCATGGACCCGTCGACTCCGTTTGTATCGCACTACCCAATGCTGGGACGACTCACCCGAGAGCAATGGCTTTTGATGCAGCAATGGCACGCTGCCCATCACTTGAGCTTTGTCGTGCCGAAC
TRN  10010101100011011
NAM  Q7UJR0_RHOBA/85-235
ASQ  KISKRSLDFHSGDEVIAEIKRLQEGGYVQTKNWNLTQICEHLDLIMTGGMEGFGFRMP--RILRATVLKWIIGRILRQ--RKMSSAPTLDRLKPKSPDGPDDPSVIDHCIETIHRAKAFDGSMED-YPFVDNMTPDMWRQFMWLHAAHHLGFLVPK
DSQ  AAGATCTCCAAGCGTTCTCTCGATTTTCATTCTGGCGATGAAGTCATCGCTGAGATCAAGCGATTGCAGGAGGGGGGCTACGTTCAAACCAAGAACTGGAACTTGACCCAAATCTGCGAGCACCTCGACCTCATCATGACCGGTGGCATGGAAGGGTTCGGGTTCCGAATGCCA------CGAATTCTTCGGGCGACGGTGCTGAAGTGGATCATCGGTCGAATATTGAGGCAA------CGCAAAATGTCGAGCGCACCAACCTTGGACCGATTGAAACCGAAGTCACCGGATGGACCCGATGATCCCAGTGTCATCGATCATTGCATCGAGACAATTCATCGGGCGAAAGCCTTTGACGGGTCGATGGAAGAC---TACCCGTTTGTTGACAACATGACGCCGGATATGTGGCGTCAGTTCATGTGGCTGCACGCGGCCCATCACCTTGGGTTTTTGGTACCCAAG
TRN  10010101100011001
//