EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07517 - SecA_DEAD)
FAM  PF07517
PID  SecA_DEAD
DES  SecA DEAD-like domain
IPR  IPR011115
ANO  70
ALN  468
AID  0.579563
APH  ((((((Q8GDT1_HELMO/5-380:0.22733,(((Q92H92_RICCN/5-389:0.21949,((Q8RI93_FUSNN/6-407:0.18759,SECA_CAUCR/5-392:0.18988):0.05257,((SECA_HELPY/6-391:0.27101,Q9PNZ1_CAMJE/6-396:0.15994):0.11463,(((Q8FYD8_BRUSU/8-391:0.13296,Q8UA54_AGRT5/8-391:0.16175):0.05757,Q89XV1_BRAJA/6-389:0.12618):0.04491,SECA_RHOCA/8-392:0.28174):0.06153):0.02013):0.03743):0.02704,(((SECA_TREPA/6-409:0.22961,SECA_BORBU/6-406:0.29340):0.19387,Q8F4S9_LEPIN/8-386:0.21341):0.13533,(((Q83F06_COXBU/6-407:0.17630,(Q9JTK7_NEIMA/6-397:0.13966,(Q8XVJ6_RALSO/6-405:0.15185,Q87AG8_XYLFT/6-398:0.18467):0.03026):0.03877):0.02445,Q82W86_NITEU/6-397:0.13855):0.03525,(Q87WZ3_PSESM/6-402:0.20838,(((SECA_HAEIN/4-400:0.17310,((Q8D301_WIGBR/6-402:0.23909,SECA_BUCAI/6-402:0.16425):0.04279,SECA_BUCBP/6-402:0.20016):0.07506):0.04621,(SECA_ECOLI/6-402:0.07771,Q8E9Q5_SHEON/6-402:0.13782):0.03814):0.03400,O87123_VIBAL/6-402:0.09873):0.07034):0.04206):0.05122):0.02624):0.04909,(Q8RCB4_THETN/8-386:0.16761,((Q8XIF0_CLOPE/4-382:0.09847,Q97F94_CLOAB/4-382:0.09634):0.04406,Q898W1_CLOTE/9-387:0.16303):0.05077):0.07043):0.03014):0.05077,((((Q97P83_STRPN/1-382:0.24285,(Q8DYM7_STRA5/3-386:0.27315,(Q8CMU9_STAEP/1-386:0.17648,Q8NUJ8_STAAW/1-386:0.24721):0.25058):0.04422):0.18217,Q98RA6_MYCPU/5-381:0.37880):0.06697,((SECA_STAAU/4-388:0.25945,(SECA_LISMO/5-382:0.12450,((Q88YL7_LACPL/5-382:0.16826,(Q8DNT8_STRR6/5-383:0.11803,Q9CJ85_LACLA/5-395:0.12611):0.04743):0.06989,Q834A7_ENTFA/5-382:0.08446):0.07310):0.04628):0.05220,((Q9K6W8_BACHD/1-383:0.15230,Q8ENI7_OCEIH/1-383:0.17535):0.07957,(Q815G7_BACCR/1-382:0.12194,SECA_BACSU/1-382:0.15026):0.01492):0.07847):0.04673):0.07452,(((Q8G4G5_BIFLO/5-384:0.17187,Q83N29_TROWT/6-385:0.26620):0.08361,SECA_STRGR/4-395:0.16712):0.02915,(Q8FRI7_COREF/4-382:0.12205,SECA1_MYCTU/2-383:0.15169):0.07599):0.15285):0.02659):0.04705,((((SECA_PAVLU/1-377:0.37224,SECA_SPIOL/85-467:0.24277):0.03919,(((((SECA_OLILU/1-379:0.33581,SECA_ODOSI/1-377:0.28130):0.12299,SECA_ANTSP/1-375:0.30566):0.06897,SECA_GUITH/1-379:0.22980):0.03439,SECA_PORPU/1-379:0.21244):0.02139,SECA_CYACA/8-386:0.38752):0.03549):0.06522,(SECA_SYNY3/1-386:0.12983,(Q8YMS8_ANASP/1-379:0.10012,SECA_SYNP7/1-397:0.13671):0.03548):0.07113):0.04594,(Q9RWU0_DEIRA/10-407:0.41888,Q9XI14_ARATH/68-451:0.28997):0.05442):0.05277):0.06334,Q81UI7_BACAN/5-383:0.30465):0.05408,(Q83YC1_LISMO/1-376:0.50754,((Q8EVL6_MYCPE/7-384:0.29688,SECA_MYCGE/6-383:0.29114):0.08977,Q9PR25_UREPA/2-384:0.24581):0.30769):0.07837):0.51643,Q8FTJ6_COREF/19-392:0.35259,SECA2_MYCLE/16-391:0.34579);
ATP  ((((((Q8GDT1_HELMO/5-380,(((Q92H92_RICCN/5-389,((Q8RI93_FUSNN/6-407,SECA_CAUCR/5-392),((SECA_HELPY/6-391,Q9PNZ1_CAMJE/6-396),(((Q8FYD8_BRUSU/8-391,Q8UA54_AGRT5/8-391),Q89XV1_BRAJA/6-389),SECA_RHOCA/8-392)))),(((SECA_TREPA/6-409,SECA_BORBU/6-406),Q8F4S9_LEPIN/8-386),(((Q83F06_COXBU/6-407,(Q9JTK7_NEIMA/6-397,(Q8XVJ6_RALSO/6-405,Q87AG8_XYLFT/6-398))),Q82W86_NITEU/6-397),(Q87WZ3_PSESM/6-402,(((SECA_HAEIN/4-400,((Q8D301_WIGBR/6-402,SECA_BUCAI/6-402),SECA_BUCBP/6-402)),(SECA_ECOLI/6-402,Q8E9Q5_SHEON/6-402)),O87123_VIBAL/6-402))))),(Q8RCB4_THETN/8-386,((Q8XIF0_CLOPE/4-382,Q97F94_CLOAB/4-382),Q898W1_CLOTE/9-387)))),((((Q97P83_STRPN/1-382,(Q8DYM7_STRA5/3-386,(Q8CMU9_STAEP/1-386,Q8NUJ8_STAAW/1-386))),Q98RA6_MYCPU/5-381),((SECA_STAAU/4-388,(SECA_LISMO/5-382,((Q88YL7_LACPL/5-382,(Q8DNT8_STRR6/5-383,Q9CJ85_LACLA/5-395)),Q834A7_ENTFA/5-382))),((Q9K6W8_BACHD/1-383,Q8ENI7_OCEIH/1-383),(Q815G7_BACCR/1-382,SECA_BACSU/1-382)))),(((Q8G4G5_BIFLO/5-384,Q83N29_TROWT/6-385),SECA_STRGR/4-395),(Q8FRI7_COREF/4-382,SECA1_MYCTU/2-383)))),((((SECA_PAVLU/1-377,SECA_SPIOL/85-467),(((((SECA_OLILU/1-379,SECA_ODOSI/1-377),SECA_ANTSP/1-375),SECA_GUITH/1-379),SECA_PORPU/1-379),SECA_CYACA/8-386)),(SECA_SYNY3/1-386,(Q8YMS8_ANASP/1-379,SECA_SYNP7/1-397))),(Q9RWU0_DEIRA/10-407,Q9XI14_ARATH/68-451))),Q81UI7_BACAN/5-383),(Q83YC1_LISMO/1-376,((Q8EVL6_MYCPE/7-384,SECA_MYCGE/6-383),Q9PR25_UREPA/2-384))),Q8FTJ6_COREF/19-392,SECA2_MYCLE/16-391);
ATL  19.7592
DNO  70
DLN  1404
DID  0.569875
DPH  (((((((((((((((((SECA_BUCBP/6-402:0.18630,SECA_BUCAI/6-402:0.16101):0.07232,Q8D301_WIGBR/6-402:0.19958):0.09189,((((Q83YC1_LISMO/1-376:0.39014,Q81UI7_BACAN/5-383:0.23475):0.08373,(((Q8CMU9_STAEP/1-386:0.23274,Q8NUJ8_STAAW/1-386:0.21676):0.13057,(Q8DYM7_STRA5/3-386:0.25221,Q97P83_STRPN/1-382:0.23374):0.08352):0.11447,((SECA_STAAU/4-388:0.24409,(SECA_LISMO/5-382:0.17988,((Q88YL7_LACPL/5-382:0.23038,(Q8DNT8_STRR6/5-383:0.21119,Q9CJ85_LACLA/5-395:0.15942):0.05352):0.08084,Q834A7_ENTFA/5-382:0.12114):0.05802):0.03283):0.05358,(((Q9K6W8_BACHD/1-383:0.24866,SECA_BACSU/1-382:0.18586):0.06482,Q815G7_BACCR/1-382:0.16163):0.03332,Q8ENI7_OCEIH/1-383:0.23047):0.04500):0.05702):0.04354):0.01821,((((SECA_CYACA/8-386:0.30685,SECA_PORPU/1-379:0.23499):0.03804,(((SECA_OLILU/1-379:0.23727,SECA_ODOSI/1-377:0.23173):0.05763,SECA_ANTSP/1-375:0.28659):0.04197,SECA_GUITH/1-379:0.24328):0.02979):0.04153,((Q9XI14_ARATH/68-451:0.31691,SECA_SPIOL/85-467:0.29103):0.05860,((SECA_SYNY3/1-386:0.17445,SECA_SYNP7/1-397:0.21995):0.07591,Q8YMS8_ANASP/1-379:0.14977):0.14038):0.07423):0.04864,((Q98RA6_MYCPU/5-381:0.27204,((Q8EVL6_MYCPE/7-384:0.20182,SECA_MYCGE/6-383:0.34028):0.07637,Q9PR25_UREPA/2-384:0.19161):0.17175):0.05606,SECA_PAVLU/1-377:0.35500):0.04812):0.04814):0.04364,((((SECA_TREPA/6-409:0.37972,SECA_BORBU/6-406:0.22823):0.11691,Q8F4S9_LEPIN/8-386:0.24751):0.08648,(SECA_HELPY/6-391:0.29820,Q9PNZ1_CAMJE/6-396:0.15781):0.09435):0.04752,(Q8RI93_FUSNN/6-407:0.18317,(((Q8RCB4_THETN/8-386:0.24747,Q97F94_CLOAB/4-382:0.14889):0.05391,Q898W1_CLOTE/9-387:0.14131):0.04540,Q8XIF0_CLOPE/4-382:0.11376):0.06879):0.06406):0.02634):0.01959):0.05920,Q92H92_RICCN/5-389:0.24307):0.06322,Q83N29_TROWT/6-385:0.42772):0.06595,Q83F06_COXBU/6-407:0.22042):0.07888,((SECA_ECOLI/6-402:0.13821,Q8E9Q5_SHEON/6-402:0.19727):0.05099,(O87123_VIBAL/6-402:0.16124,SECA_HAEIN/4-400:0.23901):0.05756):0.07518):0.07984,Q82W86_NITEU/6-397:0.17799):0.04871,Q87AG8_XYLFT/6-398:0.21383):0.06120,Q8GDT1_HELMO/5-380:0.32389):0.04265,Q9JTK7_NEIMA/6-397:0.17408):0.03714,Q87WZ3_PSESM/6-402:0.18445):0.03326,Q8XVJ6_RALSO/6-405:0.14933):0.04012,(((Q8FYD8_BRUSU/8-391:0.12802,Q8UA54_AGRT5/8-391:0.14166):0.06370,Q89XV1_BRAJA/6-389:0.09919):0.05512,(SECA_CAUCR/5-392:0.11783,SECA_RHOCA/8-392:0.22560):0.03984):0.03807):0.03665,Q9RWU0_DEIRA/10-407:0.30241):0.02905,((Q8FRI7_COREF/4-382:0.13684,SECA1_MYCTU/2-383:0.13280):0.05144,(SECA_STRGR/4-395:0.12913,Q8G4G5_BIFLO/5-384:0.15531):0.05637):0.04173):0.22689,Q8FTJ6_COREF/19-392:0.22879,SECA2_MYCLE/16-391:0.33502);
DTP  (((((((((((((((((SECA_BUCBP/6-402,SECA_BUCAI/6-402),Q8D301_WIGBR/6-402),((((Q83YC1_LISMO/1-376,Q81UI7_BACAN/5-383),(((Q8CMU9_STAEP/1-386,Q8NUJ8_STAAW/1-386),(Q8DYM7_STRA5/3-386,Q97P83_STRPN/1-382)),((SECA_STAAU/4-388,(SECA_LISMO/5-382,((Q88YL7_LACPL/5-382,(Q8DNT8_STRR6/5-383,Q9CJ85_LACLA/5-395)),Q834A7_ENTFA/5-382))),(((Q9K6W8_BACHD/1-383,SECA_BACSU/1-382),Q815G7_BACCR/1-382),Q8ENI7_OCEIH/1-383)))),((((SECA_CYACA/8-386,SECA_PORPU/1-379),(((SECA_OLILU/1-379,SECA_ODOSI/1-377),SECA_ANTSP/1-375),SECA_GUITH/1-379)),((Q9XI14_ARATH/68-451,SECA_SPIOL/85-467),((SECA_SYNY3/1-386,SECA_SYNP7/1-397),Q8YMS8_ANASP/1-379))),((Q98RA6_MYCPU/5-381,((Q8EVL6_MYCPE/7-384,SECA_MYCGE/6-383),Q9PR25_UREPA/2-384)),SECA_PAVLU/1-377))),((((SECA_TREPA/6-409,SECA_BORBU/6-406),Q8F4S9_LEPIN/8-386),(SECA_HELPY/6-391,Q9PNZ1_CAMJE/6-396)),(Q8RI93_FUSNN/6-407,(((Q8RCB4_THETN/8-386,Q97F94_CLOAB/4-382),Q898W1_CLOTE/9-387),Q8XIF0_CLOPE/4-382))))),Q92H92_RICCN/5-389),Q83N29_TROWT/6-385),Q83F06_COXBU/6-407),((SECA_ECOLI/6-402,Q8E9Q5_SHEON/6-402),(O87123_VIBAL/6-402,SECA_HAEIN/4-400))),Q82W86_NITEU/6-397),Q87AG8_XYLFT/6-398),Q8GDT1_HELMO/5-380),Q9JTK7_NEIMA/6-397),Q87WZ3_PSESM/6-402),Q8XVJ6_RALSO/6-405),(((Q8FYD8_BRUSU/8-391,Q8UA54_AGRT5/8-391),Q89XV1_BRAJA/6-389),(SECA_CAUCR/5-392,SECA_RHOCA/8-392))),Q9RWU0_DEIRA/10-407),((Q8FRI7_COREF/4-382,SECA1_MYCTU/2-383),(SECA_STRGR/4-395,Q8G4G5_BIFLO/5-384))),Q8FTJ6_COREF/19-392,SECA2_MYCLE/16-391);
DTL  19.4868
RID  0.579563
RPH  ((((((Q8GDT1_HELMO/5-380:0.22733,(((Q92H92_RICCN/5-389:0.21949,((Q8RI93_FUSNN/6-407:0.18759,SECA_CAUCR/5-392:0.18988):0.05257,((SECA_HELPY/6-391:0.27101,Q9PNZ1_CAMJE/6-396:0.15994):0.11463,(((Q8FYD8_BRUSU/8-391:0.13296,Q8UA54_AGRT5/8-391:0.16175):0.05757,Q89XV1_BRAJA/6-389:0.12618):0.04491,SECA_RHOCA/8-392:0.28174):0.06153):0.02013):0.03743):0.02704,(((SECA_TREPA/6-409:0.22961,SECA_BORBU/6-406:0.29340):0.19387,Q8F4S9_LEPIN/8-386:0.21341):0.13533,(((Q83F06_COXBU/6-407:0.17630,(Q9JTK7_NEIMA/6-397:0.13966,(Q8XVJ6_RALSO/6-405:0.15185,Q87AG8_XYLFT/6-398:0.18467):0.03026):0.03877):0.02445,Q82W86_NITEU/6-397:0.13855):0.03525,(Q87WZ3_PSESM/6-402:0.20838,(((SECA_HAEIN/4-400:0.17310,((Q8D301_WIGBR/6-402:0.23909,SECA_BUCAI/6-402:0.16425):0.04279,SECA_BUCBP/6-402:0.20016):0.07506):0.04621,(SECA_ECOLI/6-402:0.07771,Q8E9Q5_SHEON/6-402:0.13782):0.03814):0.03400,O87123_VIBAL/6-402:0.09873):0.07034):0.04206):0.05122):0.02624):0.04909,(Q8RCB4_THETN/8-386:0.16761,((Q8XIF0_CLOPE/4-382:0.09847,Q97F94_CLOAB/4-382:0.09634):0.04406,Q898W1_CLOTE/9-387:0.16303):0.05077):0.07043):0.03014):0.05077,((((Q97P83_STRPN/1-382:0.24285,(Q8DYM7_STRA5/3-386:0.27315,(Q8CMU9_STAEP/1-386:0.17648,Q8NUJ8_STAAW/1-386:0.24721):0.25058):0.04422):0.18217,Q98RA6_MYCPU/5-381:0.37880):0.06697,((SECA_STAAU/4-388:0.25945,(SECA_LISMO/5-382:0.12450,((Q88YL7_LACPL/5-382:0.16826,(Q8DNT8_STRR6/5-383:0.11803,Q9CJ85_LACLA/5-395:0.12611):0.04743):0.06989,Q834A7_ENTFA/5-382:0.08446):0.07310):0.04628):0.05220,((Q9K6W8_BACHD/1-383:0.15230,Q8ENI7_OCEIH/1-383:0.17535):0.07957,(Q815G7_BACCR/1-382:0.12194,SECA_BACSU/1-382:0.15026):0.01492):0.07847):0.04673):0.07452,(((Q8G4G5_BIFLO/5-384:0.17187,Q83N29_TROWT/6-385:0.26620):0.08361,SECA_STRGR/4-395:0.16712):0.02915,(Q8FRI7_COREF/4-382:0.12205,SECA1_MYCTU/2-383:0.15169):0.07599):0.15285):0.02659):0.04705,((((SECA_PAVLU/1-377:0.37224,SECA_SPIOL/85-467:0.24277):0.03919,(((((SECA_OLILU/1-379:0.33581,SECA_ODOSI/1-377:0.28130):0.12299,SECA_ANTSP/1-375:0.30566):0.06897,SECA_GUITH/1-379:0.22980):0.03439,SECA_PORPU/1-379:0.21244):0.02139,SECA_CYACA/8-386:0.38752):0.03549):0.06522,(SECA_SYNY3/1-386:0.12983,(Q8YMS8_ANASP/1-379:0.10012,SECA_SYNP7/1-397:0.13671):0.03548):0.07113):0.04594,(Q9RWU0_DEIRA/10-407:0.41888,Q9XI14_ARATH/68-451:0.28997):0.05442):0.05277):0.06334,Q81UI7_BACAN/5-383:0.30465):0.05408,(Q83YC1_LISMO/1-376:0.50754,((Q8EVL6_MYCPE/7-384:0.29688,SECA_MYCGE/6-383:0.29114):0.08977,Q9PR25_UREPA/2-384:0.24581):0.30769):0.07837):0.51643,Q8FTJ6_COREF/19-392:0.35259,SECA2_MYCLE/16-391:0.34579);
RTP  ((((((Q8GDT1_HELMO/5-380,(((Q92H92_RICCN/5-389,((Q8RI93_FUSNN/6-407,SECA_CAUCR/5-392),((SECA_HELPY/6-391,Q9PNZ1_CAMJE/6-396),(((Q8FYD8_BRUSU/8-391,Q8UA54_AGRT5/8-391),Q89XV1_BRAJA/6-389),SECA_RHOCA/8-392)))),(((SECA_TREPA/6-409,SECA_BORBU/6-406),Q8F4S9_LEPIN/8-386),(((Q83F06_COXBU/6-407,(Q9JTK7_NEIMA/6-397,(Q8XVJ6_RALSO/6-405,Q87AG8_XYLFT/6-398))),Q82W86_NITEU/6-397),(Q87WZ3_PSESM/6-402,(((SECA_HAEIN/4-400,((Q8D301_WIGBR/6-402,SECA_BUCAI/6-402),SECA_BUCBP/6-402)),(SECA_ECOLI/6-402,Q8E9Q5_SHEON/6-402)),O87123_VIBAL/6-402))))),(Q8RCB4_THETN/8-386,((Q8XIF0_CLOPE/4-382,Q97F94_CLOAB/4-382),Q898W1_CLOTE/9-387)))),((((Q97P83_STRPN/1-382,(Q8DYM7_STRA5/3-386,(Q8CMU9_STAEP/1-386,Q8NUJ8_STAAW/1-386))),Q98RA6_MYCPU/5-381),((SECA_STAAU/4-388,(SECA_LISMO/5-382,((Q88YL7_LACPL/5-382,(Q8DNT8_STRR6/5-383,Q9CJ85_LACLA/5-395)),Q834A7_ENTFA/5-382))),((Q9K6W8_BACHD/1-383,Q8ENI7_OCEIH/1-383),(Q815G7_BACCR/1-382,SECA_BACSU/1-382)))),(((Q8G4G5_BIFLO/5-384,Q83N29_TROWT/6-385),SECA_STRGR/4-395),(Q8FRI7_COREF/4-382,SECA1_MYCTU/2-383)))),((((SECA_PAVLU/1-377,SECA_SPIOL/85-467),(((((SECA_OLILU/1-379,SECA_ODOSI/1-377),SECA_ANTSP/1-375),SECA_GUITH/1-379),SECA_PORPU/1-379),SECA_CYACA/8-386)),(SECA_SYNY3/1-386,(Q8YMS8_ANASP/1-379,SECA_SYNP7/1-397))),(Q9RWU0_DEIRA/10-407,Q9XI14_ARATH/68-451))),Q81UI7_BACAN/5-383),(Q83YC1_LISMO/1-376,((Q8EVL6_MYCPE/7-384,SECA_MYCGE/6-383),Q9PR25_UREPA/2-384))),Q8FTJ6_COREF/19-392,SECA2_MYCLE/16-391);
RTL  19.7592
LNK  O87123_VIBAL/6-402:O87123:AB012226
LNK  Q815G7_BACCR/1-382:Q815G7:AE017014
LNK  Q81UI7_BACAN/5-383:Q81UI7:AE017027
LNK  Q82W86_NITEU/6-397:Q82W86:BX321858
LNK  Q834A7_ENTFA/5-382:Q834A7:AE016952
LNK  Q83F06_COXBU/6-407:Q83F06:AE016960
LNK  Q83N29_TROWT/6-385:Q83N29:AE016850
LNK  Q83YC1_LISMO/1-376:Q83YC1:AY256850
LNK  Q87AG8_XYLFT/6-398:Q87AG8:AE012560
LNK  Q87WZ3_PSESM/6-402:Q87WZ3:AE016871
LNK  Q88YL7_LACPL/5-382:Q88YL7:AL935254
LNK  Q898W1_CLOTE/9-387:Q898W1:AE015937
LNK  Q89XV1_BRAJA/6-389:Q89XV1:BA000040
LNK  Q8CMU9_STAEP/1-386:Q8CMU9:AE016751
LNK  Q8D301_WIGBR/6-402:Q8D301:BA000021
LNK  Q8DNT8_STRR6/5-383:Q8DNT8:AE008523
LNK  Q8DYM7_STRA5/3-386:Q8DYM7:AE014258
LNK  Q8E9Q5_SHEON/6-402:Q8E9Q5:AE015853
LNK  Q8ENI7_OCEIH/1-383:Q8ENI7:BA000028
LNK  Q8EVL6_MYCPE/7-384:Q8EVL6:BA000026
LNK  Q8F4S9_LEPIN/8-386:Q8F4S9:AE011368
LNK  Q8FRI7_COREF/4-382:Q8FRI7:BA000035
LNK  Q8FTJ6_COREF/19-392:Q8FTJ6:BA000035
LNK  Q8FYD8_BRUSU/8-391:Q8FYD8:AE014291
LNK  Q8G4G5_BIFLO/5-384:Q8G4G5:AE014772
LNK  Q8GDT1_HELMO/5-380:Q8GDT1:AY142893
LNK  Q8NUJ8_STAAW/1-386:Q8NUJ8:BA000033
LNK  Q8RCB4_THETN/8-386:Q8RCB4:AE013022
LNK  Q8RI93_FUSNN/6-407:Q8RI93:AE010476
LNK  Q8UA54_AGRT5/8-391:Q8UA54:AE009281
LNK  Q8XIF0_CLOPE/4-382:Q8XIF0:BA000016
LNK  Q8XVJ6_RALSO/6-405:Q8XVJ6:AL646072
LNK  Q8YMS8_ANASP/1-379:Q8YMS8:BA000019
LNK  Q92H92_RICCN/5-389:Q92H92:AE008642
LNK  Q97F94_CLOAB/4-382:Q97F94:AE007782
LNK  Q97P83_STRPN/1-382:Q97P83:AE007468
LNK  Q98RA6_MYCPU/5-381:Q98RA6:AL445563
LNK  Q9CJ85_LACLA/5-395:Q9CJ85:AE006249
LNK  Q9JTK7_NEIMA/6-397:Q9JTK7:AL162757
LNK  Q9K6W8_BACHD/1-383:Q9K6W8:BA000004
LNK  Q9PNZ1_CAMJE/6-396:Q9PNZ1:AL139076
LNK  Q9PR25_UREPA/2-384:Q9PR25:AE002112
LNK  Q9RWU0_DEIRA/10-407:Q9RWU0:AE001916
LNK  Q9XI14_ARATH/68-451:Q9XI14:AC007727
LNK  SECA1_MYCTU/2-383:O05885:BX842582
LNK  SECA2_MYCLE/16-391:O32922:AL008609
LNK  SECA_ANTSP/1-375:Q06461:X64705
LNK  SECA_BACSU/1-382:P28366:D10279
LNK  SECA_BORBU/6-406:O07497:AE001126
LNK  SECA_BUCAI/6-402:P57297:AP001118
LNK  SECA_BUCBP/6-402:Q89AR1:AE014016
LNK  SECA_CAUCR/5-392:P38380:AE005970
LNK  SECA_CYACA/8-386:O19911:AF022186
LNK  SECA_ECOLI/6-402:P10408:M20791
LNK  SECA_GUITH/1-379:O78441:AF041468
LNK  SECA_HAEIN/4-400:P43803:U32772
LNK  SECA_HELPY/6-391:O25475:AE000590
LNK  SECA_LISMO/5-382:P47847:AL591983
LNK  SECA_MYCGE/6-383:P47318:U39687
LNK  SECA_ODOSI/1-377:P49649:Z67753
LNK  SECA_OLILU/1-379:Q32743:Z35718
LNK  SECA_PAVLU/1-377:Q01570:X65961
LNK  SECA_PORPU/1-379:P51381:U38804
LNK  SECA_RHOCA/8-392:P52966:X89411
LNK  SECA_SPIOL/85-467:Q36795:Z49124
LNK  SECA_STAAU/4-388:O06446:U97062
LNK  SECA_STRGR/4-395:P95759:Y10980
LNK  SECA_SYNP7/1-397:Q55357:X74592
LNK  SECA_SYNY3/1-386:Q55709:D64002
LNK  SECA_TREPA/6-409:O83394:AE001217
AMK  ..xxxxxxxx.xxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.....xxxxx.....xxx.xxx....xx.....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxx....................................................................................................................................................................xxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxx
DMK  ......xxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx........................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...............xxxxxxxxxxxxxxx...............xxxxxxxxx...xxxxxxxxx............xxxxxx...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9PR25_UREPA/2-384
ASQ  ..NLISKIS-.-PQNRILNR.ARLIAEEVLKKEEEYEHFSDQELINKSDDIIEYLANNN........PLDDKLVEALCIIREVIYRVHNKRAFKVQIIGAIIVYFGDFAEMMTGEGKTLTLVLVAYLNALYKKGVHMVTVNEYLVKVGAEFATPVLNFLNMS.....VGQIT.....ANM.NEY....EK.....RNNYNCDITYTTNSELGFDYLRDNMVTNYANKVQR...GLWFAIVDEGDSVLIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEQIKIEPENLTVATITY.QSLFRLYKKLAAVSGTAITEAEEFL
DSQ  ......AATTTAATATCAAAAATATCC---...---CCCCAAAACCGAATCTTAAATCGC...GCTCGATTGATTGCTGAAGAAGTTTTAAAAAAAGAAGAAGAATACGAACATTTTAGCGATCAAGAATTAATTAATAAATCTGATGATATTATTGAATATTTAGCAAATAATAAC........................CCATTAGATGATAAATTAGTAGAAGCATTATGCATTATTCGTGAAGTGATTTATCGAGTTCATAATAAAAGAGCTTTTAAAGTTCAAATTATTGGTGCAATTATTGTTTATTTTGGTGATTTTGCTGAAATGATGACTGGTGAGGGTAAAACATTAACTTTAGTTTTAGTTGCTTATTTAAATGCACTTTATAAAAAAGGTGTTCATATGGTAACTGTTAACGAATATCTAGTTAAAGTTGGAGCAGAATTTGCAACACCTGTTTTAAATTTTTTAAATATGTCT...............GTTGGCCAAATTACA...............GCTAATATG...AATGAGTAT............GAAAAA...............CGAAATAATTATAATTGTGATATCACATATACAACTAATTCAGAATTAGGCTTTGATTATTTACGTGATAATATGGTAACTAATTATGCTAATAAAGTTCAACGG.........GGCTTATGATTTGCTATTGTTGATGAAGGTGATTCTGTTTTAATTGATGAAGCTCGGACTCCTTTAATCATTTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAACAAATTAAAATTGAACCCGAAAATTTAACAGTTGCCACAATCACTTAT...CAATCATTATTTCGTTTATATAAAAAATTAGCAGCAGTTTCAGGAACAGCTATTACTGAAGCAGAAGAATTTTTA
TRN  00010000000000000
NAM  SECA_MYCGE/6-383
ASQ  flKLISPKN-.----RILSK.ANRIASEVESYKNYYRNLTDQQLFEESNKLVDLVTKQN.......yTILDVCVAALALIREVVYRETGEFAYRVQIIGAFIVLSGDFAEMMTGEGKTLTIVLAAYVSALEKRGVHVVTVNEYLAQRDANNAMKILKRVGMS.....VGCNF.....ANL.SPQ....LK.....QAAFNCDVTYTTNSELGFDYLRDNMVHSYQDKKIR...ELHFAIVDEGDSVLIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEYVEIEPENVIVATITY.QSFFRLYNRLAAVSGTALTESEEFL
DSQ  ttccttAAGTTAATTTCACCCAAAAAC---...------------AGAATTCTCAGTAAG...GCAAATAGGATTGCCAGTGAGGTTGAGAGTTATAAAAACTACTACCGTAACTTAACTGATCAACAGTTATTTGAAGAGTCAAATAAACTAGTTGATCTTGTCACTAAGCAAAAT.....................tacACCATTCTAGATGTTTGTGTTGCTGCACTTGCTTTAATTAGAGAAGTGGTTTACCGTGAGACTGGTGAATTTGCATATAGGGTGCAGATCATAGGAGCTTTTATTGTTTTAAGTGGTGATTTTGCTGAGATGATGACTGGTGAAGGTAAGACCTTAACCATTGTTTTAGCAGCATACGTTTCTGCACTTGAAAAGCGTGGTGTGCATGTTGTTACTGTTAATGAATATCTAGCTCAAAGGGATGCTAATAATGCAATGAAGATCTTAAAACGGGTTGGGATGAGT...............GTCGGTTGTAACTTT...............GCTAATCTC...TCCCCTCAG............CTAAAA...............CAAGCTGCATTTAATTGCGATGTTACCTACACCACTAACAGTGAACTGGGGTTTGATTATCTTAGAGATAACATGGTCCACAGTTATCAAGATAAGAAGATCAGA.........GAGTTGCACTTTGCAATAGTTGATGAAGGTGATTCAGTTTTAATTGATGAGGCGCGAACGCCTTTAATTATTTCAGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAAGAATATGTTGAGATAGAACCTGAAAATGTGATAGTAGCTACCATTACCTAC...CAATCCTTCTTTAGGCTATACAACCGCTTAGCAGCAGTATCAGGTACTGCTTTAACTGAATCAGAGGAGTTTCTC
TRN  10010101100011000
NAM  Q8EVL6_MYCPE/7-384
ASQ  kfKKIKKKS-.----KILVK.AKLIAQQVENNREEYSALSIEDLRIRTDYLVDGLAKDK.......fTLEDIIVDALSIAREIIYREHGMLAYEVQMMGAYVVHTGDFAEMYTGEGKSLTLLLVSFVNALTKRGVHIVTVNEYLVERDALFAQKAFEKLGIT.....VGYNT.....SKL.SKA....TK.....KEMFARDITYTTNSELGFDYLKDNMVRDINEKVIR...ELFFVIVDEADSVLIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKERVTIEPENVVMATITY.QSFFRLYEKLSGVSGTAMTEAEEFL
DSQ  aaattcAAAAAAATTAAAAAGAAATCT---...------------AAAATCCTTGTTAAG...GCAAAACTAATTGCTCAACAAGTTGAAAATAACCGTGAAGAATATAGTGCTTTATCAATTGAAGACTTAAGGATTAGAACTGATTATTTAGTAGATGGTTTAGCTAAAGATAAA.....................ttcACACTAGAAGATATCATTGTTGATGCTTTATCAATTGCAAGAGAAATCATTTATCGTGAACATGGTATGCTAGCTTATGAAGTTCAAATGATGGGTGCATATGTTGTTCATACTGGTGACTTTGCTGAAATGTATACTGGGGAAGGTAAGAGTTTAACCTTACTTTTAGTTTCTTTTGTAAATGCCCTTACAAAACGTGGTGTTCATATTGTTACTGTTAATGAATATCTAGTTGAAAGAGATGCTTTATTTGCTCAAAAAGCTTTTGAAAAATTAGGAATAACT...............GTAGGTTATAACACT...............TCAAAATTA...AGTAAAGCA............ACAAAA...............AAAGAAATGTTTGCAAGAGACATAACTTATACTACTAACTCAGAACTTGGTTTTGATTATCTTAAAGACAATATGGTTAGAGATATCAATGAAAAAGTTATTAGA.........GAATTATTTTTTGTAATTGTCGATGAAGCTGACTCTGTTTTAATTGATGAAGCTAGAACTCCTTTAATTATTTCAGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAAGAGTAACAATTGAACCTGAAAATGTTGTAATGGCAACAATTACTTAT...CAATCATTTTTTAGACTTTATGAAAAATTGTCAGGTGTAAGTGGAACTGCAATGACTGAAGCTGAAGAATTCTTG
TRN  10010101110011000
NAM  Q82W86_NITEU/6-397
ASQ  lkSIFGSRND.----RLIKQ.YLKIVRTINELEAAISPLSDEELRAKTSEFKQRVANGE........KLDQLLPEAFAVVREAGKRVLGMRHFDVQLIGGMVLHEGKIAEMRTGEGKTLMATLPTYLNALSGKGVHIVTVNDYLAKRDAEWMGQIYRFLGLT.....VGVVL.....SQM.PHE....EK.....QAAYAADITYGTNNEYGFDYLRDNMVGHSAERVQR...VLNFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVPIQKENQTLASITF.QNYFRMYEKLAGMTGTADTEAFEFQ
DSQ  ctaaagAGTATTTTTGGCAGCCGTAACGAC...------------CGGCTGATAAAACAG...TATTTGAAGATCGTTCGCACCATCAATGAGCTGGAAGCCGCGATTTCACCACTGTCAGATGAGGAATTGCGCGCCAAGACAAGTGAGTTCAAACAGCGTGTCGCAAACGGAGAG........................AAGCTGGATCAGTTGTTGCCCGAAGCATTTGCCGTGGTCAGAGAAGCGGGAAAGCGTGTGCTGGGTATGCGCCATTTCGATGTACAGTTGATCGGTGGCATGGTTCTGCATGAAGGAAAAATTGCCGAGATGCGTACCGGTGAGGGAAAAACGCTGATGGCGACGTTGCCGACCTATCTGAATGCACTATCGGGCAAAGGAGTGCATATCGTTACGGTCAATGATTATCTGGCAAAGCGTGATGCGGAATGGATGGGGCAGATTTACCGCTTTCTCGGGCTGACT...............GTCGGCGTGGTGCTG...............TCACAAATG...CCTCATGAG............GAAAAA...............CAGGCTGCTTATGCCGCAGATATAACCTACGGCACGAACAATGAATATGGCTTTGATTATCTGCGTGACAATATGGTGGGACATAGCGCGGAACGGGTACAGCGC.........GTGCTGAATTTTGCAATTGTGGATGAGGTCGATTCGATTCTGATCGATGAAGCTCGCACGCCGCTCATTATTTCCGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAAAACGTTCCGATTCAGAAAGAAAACCAGACTCTGGCATCCATTACCTTC...CAGAATTATTTCCGGATGTATGAAAAACTTGCCGGCATGACCGGTACTGCCGATACGGAAGCATTCGAGTTCCAA
TRN  10010101100011001
NAM  Q8XVJ6_RALSO/6-405
ASQ  lkKIFGSRNE.----RLIKQ.YRRKVVQINALEPTFEALSDAELQAKTQAFRERFAKGE........TLDALLPEAFAVCREASKRVMKMRHFDVQLIGGMVLHDGKIAEMRTGEGKTLTATLAVYLNAIAGLGVHVVTVNDYLAQRDAEWMGKLYNWLGLS.....VGVNL.....TTM.AHD....EK.....QAAYAADITYGTNNEFGFDYLRDNMVYDDSQRVQR...PLNYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVQIQQENQTLATITF.QNYFRMYAKLAGMTGTADTEAYEFQ
DSQ  ctcaagAAGATTTTCGGCAGCCGCAACGAA...------------CGGCTGATCAAACAG...TACCGCCGCAAGGTGGTGCAGATCAACGCGCTCGAACCCACGTTCGAGGCGCTTTCCGATGCCGAACTGCAGGCCAAGACCCAGGCATTCCGCGAGCGCTTCGCCAAGGGCGAG........................ACCCTCGACGCGCTGCTGCCCGAAGCATTCGCCGTGTGTCGCGAAGCCAGCAAGCGCGTGATGAAGATGCGCCATTTCGACGTGCAGCTGATCGGCGGCATGGTGCTGCACGATGGCAAGATCGCCGAAATGCGCACTGGCGAAGGCAAGACGCTGACCGCCACGCTGGCGGTCTACCTGAATGCGATCGCCGGGCTGGGCGTGCACGTGGTGACGGTCAACGACTACCTGGCCCAGCGCGATGCCGAATGGATGGGCAAGCTCTACAACTGGCTGGGCCTGTCG...............GTCGGGGTCAACCTG...............ACCACCATG...GCCCACGAT............GAGAAG...............CAAGCCGCCTACGCTGCCGACATCACCTACGGTACCAACAACGAGTTCGGCTTCGACTACCTGCGCGACAACATGGTGTACGACGACAGCCAGCGCGTGCAGCGT.........CCGCTGAACTACGCCATCGTCGACGAGGTGGACTCGATCCTGATCGATGAAGCCCGCACGCCGCTGATCATCTCCGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAAGGCGTGCAGATCCAGCAGGAAAACCAGACGCTGGCGACCATCACCTTC...CAGAACTACTTCCGCATGTACGCCAAGCTGGCGGGCATGACCGGCACGGCCGATACCGAAGCCTACGAGTTCCAG
TRN  11011101101011011
NAM  Q9JTK7_NEIMA/6-397
ASQ  akKIFGSRND.----RLLKQ.YRKSVARINALEEQMQALSDADLQAKTAEFKQRLADGQ........TLDGILPEAFAVCREASRRTLGMRHFDVQLIGGMVLHDGKIAEMRTGEGKTLVATLAVYLNALAGKGVHVVTVNDYLASRDAGIMEPLYNFLGLT.....VGVII.....SDM.QPF....DR.....QNAYAADITYGTNNEFGFDYLRDNMVTDQYDKVQR...ELNFAVVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEIKRENQTLASITF.QNYFRLYTKLSGMTGTADTEAFEFQ
DSQ  gccaagAAAATCTTCGGCAGCCGCAACGAC...------------CGCTTGCTGAAACAA...TACCGTAAATCCGTTGCCAGAATCAACGCGCTCGAAGAACAGATGCAAGCCCTAAGCGATGCTGATCTGCAAGCCAAAACTGCCGAATTCAAACAACGCCTCGCCGACGGTCAG........................ACTTTGGACGGCATTTTGCCCGAAGCCTTCGCCGTCTGCCGCGAAGCGTCCCGCCGCACCCTCGGTATGCGCCACTTCGACGTGCAGCTTATCGGCGGTATGGTGCTGCACGACGGCAAAATCGCCGAAATGCGTACCGGCGAAGGCAAAACCCTGGTCGCCACCCTCGCCGTCTATCTCAACGCGCTGGCCGGCAAAGGCGTACACGTCGTTACCGTCAACGACTACCTCGCCTCACGCGATGCGGGCATTATGGAGCCGCTCTACAATTTCCTCGGCCTTACC...............GTGGGCGTGATTATT...............TCAGATATG...CAGCCGTTC............GACCGT...............CAAAACGCCTATGCCGCCGATATCACCTACGGCACCAATAATGAATTCGGCTTCGACTACCTGCGCGACAATATGGTTACCGACCAATACGACAAAGTGCAGCGC.........GAATTGAATTTTGCCGTTGTCGATGAAGTGGATTCCATCTTGATTGACGAAGCGCGCACTCCGCTGATTATCTCCGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAAGAAGGCGTGGAAATCAAACGCGAAAACCAAACCCTCGCCTCCATCACCTTC...CAAAACTATTTCCGCCTGTACACCAAGCTCTCCGGTATGACCGGTACGGCAGATACCGAGGCTTTCGAGTTCCAA
TRN  10010101100011001
NAM  Q87AG8_XYLFT/6-398
ASQ  ltRLFGSRNE.----RQLRQ.LNSIVAKINALEAELQKLSDTALQAKTTEFKQSIQDGK........SLDKLLPEAFAVCREASRRVLGMRHYDVQLIGGMVLHLGKIAEMRTGEGKTLVATLPVYLNALAGKGVHVVTVNDYLARRDAAHMGRLYNWLGLS.....VGVVY.....PGM.PHS....DK.....HAAYGADITYGTNNEFGFDYLRDNMALSKADRYQR...GLHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVPVQRENQTLASITF.QNLFRIYKKLSGMTGTADTEAYEFQ
DSQ  cttaccCGACTTTTTGGCAGTCGTAACGAA...------------CGCCAGCTTCGCCAA...CTAAACTCCATCGTAGCTAAGATCAATGCTTTGGAGGCGGAGTTACAGAAGCTTTCCGATACGGCACTCCAGGCCAAGACAACCGAATTCAAACAGTCCATCCAAGATGGAAAG........................TCGTTGGATAAATTGCTGCCGGAAGCATTTGCAGTGTGCCGTGAGGCCAGTCGTCGTGTGCTGGGTATGCGCCACTACGACGTGCAGTTGATCGGTGGCATGGTGCTGCATTTGGGCAAGATTGCCGAAATGCGTACCGGCGAGGGAAAGACCTTGGTAGCGACGTTGCCTGTCTATTTGAATGCGCTGGCAGGCAAGGGTGTACACGTGGTCACCGTGAACGATTATCTCGCCCGCCGCGATGCCGCTCATATGGGAAGACTGTACAACTGGTTAGGTTTGAGC...............GTTGGTGTGGTTTAT...............CCAGGGATG...CCGCACAGC............GACAAG...............CACGCGGCCTATGGCGCTGATATTACTTACGGTACTAATAATGAGTTTGGCTTCGATTACCTGCGGGACAATATGGCGTTGTCTAAAGCAGATCGTTACCAGCGT.........GGGTTGCACTATGCGATTGTTGACGAAGTGGACTCAATTCTGATTGACGAAGCCCGTACTCCACTCATCATTTCCGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCGAAGGAAGGAGTGCCTGTACAACGCGAAAATCAGACGCTGGCCTCGATTACCTTC...CAGAACTTGTTCCGTATCTATAAAAAACTGTCCGGTATGACAGGGACTGCGGACACAGAAGCGTACGAATTCCAA
TRN  10010101100011000
NAM  Q83F06_COXBU/6-407
ASQ  ikKAFGTRNE.----RLLKG.YSKIVSRINALEPEIQALSDADLRAKTDEFKKRLVDGE........GLDALLPEAFAVVRETSVRTLGLRHFDVQIIGGLALHGGKIAEMRTGEGKTLGATMPAYLNALTGKGVHIVTVNDYLAKRDAEWMKPIYEFLGLT.....VGVNV.....PGM.EPV....EK.....QAAYAADITYGTNNEFGFDYLRDNMVFDLDQRVQR...PLHYAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGATIQLENQTLATITF.QNYFRLYEKLSGMTATADTEAFELQ
DSQ  atcaagAAAGCTTTCGGTACGCGTAATGAG...------------CGTTTGCTTAAAGGC...TATTCCAAAATAGTATCAAGAATTAATGCCCTAGAGCCAGAAATCCAGGCCCTTTCCGATGCCGACCTTCGCGCTAAAACCGATGAATTCAAAAAACGCTTAGTCGATGGGGAA........................GGACTCGATGCTTTATTGCCGGAAGCGTTTGCGGTGGTTCGGGAAACGAGCGTTCGCACGCTCGGCCTTCGTCATTTCGACGTCCAAATAATCGGTGGCCTGGCACTCCATGGTGGAAAAATTGCTGAAATGCGTACTGGCGAAGGAAAAACCTTAGGCGCTACGATGCCAGCTTATTTGAACGCATTAACGGGCAAAGGCGTTCACATCGTCACGGTAAATGATTATTTAGCTAAGCGTGACGCTGAATGGATGAAGCCTATTTATGAATTCCTCGGTTTGACG...............GTGGGCGTTAACGTG...............CCTGGAATG...GAGCCGGTT............GAGAAA...............CAAGCGGCTTATGCGGCTGATATCACTTACGGCACCAATAACGAATTCGGTTTCGATTATTTACGCGATAACATGGTTTTTGATTTGGATCAACGCGTGCAGCGG.........CCATTGCATTACGCGATCATTGACGAAGTGGATTCCATTTTAATTGACGAAGCTAGAACACCCTTAATTATTTCAGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGTGCAACTATTCAATTAGAAAATCAGACATTGGCTACTATTACGTTC...CAAAACTATTTCCGCCTTTATGAAAAATTATCCGGTATGACTGCCACCGCGGATACCGAAGCCTTCGAGTTGCAA
TRN  10010101100011000
NAM  Q87WZ3_PSESM/6-402
ASQ  lkKLFGSKNE.----REVKR.MLKTVQIVNAFEEQMVALSDEQLRAKTEEFKARIAKGE........TLDQLLPEAFAVAREAGKRVMGMRHFDVQLIGGMTLHEGQIAEMRTGEGKTLVGTLAVYLNALSGKGVHVVTVNDYLARRDANWMRPLYEFLGLT.....VGIVT.....PFQ.PPE....EK.....RAAYAADITYGTNNEYGFDYLRDNMAFSMDDKFQR...ELNFAVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENLNIQAESQTLASTTF.QNYFRLYNKLSGMTGTADTEAFEFH
DSQ  ttgaaaAAACTTTTTGGAAGCAAGAACGAG...------------CGTGAAGTCAAACGC...ATGCTCAAGACGGTACAGATCGTCAATGCCTTCGAAGAGCAAATGGTGGCCCTTTCGGACGAGCAATTGCGCGCCAAGACCGAAGAGTTCAAGGCCCGCATAGCCAAAGGCGAG........................ACCCTCGATCAATTGCTGCCTGAAGCCTTCGCGGTGGCCCGTGAAGCGGGCAAGCGTGTCATGGGCATGCGCCACTTCGACGTTCAGTTGATCGGCGGCATGACCCTGCACGAAGGTCAGATCGCAGAAATGCGTACCGGTGAAGGTAAAACCCTCGTCGGCACCTTGGCTGTGTACCTCAATGCGTTGTCCGGCAAGGGCGTTCACGTGGTTACCGTGAACGACTACCTCGCTCGCCGCGACGCCAACTGGATGCGCCCGCTGTACGAATTCCTCGGTCTGACC...............GTCGGCATCGTCACG...............CCATTCCAG...CCGCCGGAA............GAGAAG...............CGCGCCGCCTACGCTGCCGACATCACCTACGGCACCAATAACGAATACGGCTTCGATTACCTGCGCGACAACATGGCGTTCAGCATGGACGACAAGTTCCAGCGC.........GAACTCAACTTCGCCGTGATCGACGAAGTCGACTCGATTCTGATCGACGAAGCGCGCACGCCGTTGATCATCTCGGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAAAACCTGAACATTCAGGCTGAAAGCCAGACCCTGGCCTCGACCACCTTC...CAGAACTACTTCCGTCTGTACAACAAACTGTCCGGCATGACCGGTACGGCCGACACCGAAGCGTTCGAATTCCAC
TRN  10010101100011011
NAM  SECA_BUCAI/6-402
ASQ  ltKIFSNHNN.----RILKK.FKKIVLSVNKLEKNFEKLSDKELQAQTELFRLRLRNGE........TLDDILPEAFALVREASKRVFSMRHFDVQILGGIALNKQCIAEMRTGEGKTLTSTLPAYLNALNGKGVHIVTMNDYLARRDAEKNTPLFEFLGLT.....VGLNL.....SEM.SFF....SK.....RKAYLSDITYGTNNEYGFDYLRDNMVFSPEERVQR...KLNYALVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVSIKNENQTLASITF.QNYFRLYEKIAGMTGTAETESFEFN
DSQ  ttaactAAAATATTTAGTAACCATAATAAT...------------CGAATTTTAAAAAAG...TTCAAAAAAATAGTTTTATCTGTCAATAAATTAGAAAAAAACTTTGAAAAGTTATCAGATAAAGAATTACAAGCACAAACAGAACTGTTTCGTTTACGATTAAGAAATGGTGAA........................ACTTTAGATGATATATTACCAGAAGCGTTTGCTTTAGTCAGAGAAGCGAGTAAACGTGTTTTTAGCATGCGTCATTTTGATGTTCAAATTCTTGGCGGAATTGCTTTGAACAAACAATGTATTGCAGAAATGCGTACAGGTGAAGGAAAAACTCTAACATCCACATTGCCGGCTTATTTAAATGCATTAAATGGAAAGGGTGTACACATAGTAACCATGAATGATTATTTAGCTCGTAGAGATGCTGAAAAAAATACTCCTTTATTTGAATTTTTGGGTTTAACA...............GTAGGTTTAAACTTA...............TCCGAAATG...TCTTTTTTT............TCTAAA...............CGTAAAGCTTATTTATCTGATATCACTTATGGTACAAATAACGAATATGGTTTTGATTATTTACGTGATAATATGGTTTTTTCTCCTGAAGAAAGAGTACAAAGA.........AAATTAAATTATGCTTTAGTTGATGAAGTAGACTCGATTTTAATAGATGAAGCTAGAACACCTTTAATTATTTCAGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAGAATGTTTCTATAAAAAATGAAAATCAAACTTTAGCATCTATTACTTTT...CAAAATTATTTTCGTTTATATGAAAAAATAGCAGGTATGACGGGTACTGCTGAAACTGAATCGTTTGAGTTTAAC
TRN  10010101100011000
NAM  Q8E9Q5_SHEON/6-402
ASQ  ltKVFGSRND.----RTLKG.LQKVVNKINALEADYEKLTDEQLKAKTAEFRERLAAGA........SLDSIMAEAFATVREASKRVFEMRHFDVQLLGGMVLDSNRIAEMRTGEGKTLTATLPAYLNALTGKGVHVITVNDYLARRDAENNRPLFEFLGLT.....VGINV.....AGL.GQQ....DK.....KDAYNADITYGTNNEFGFDYLRDNMAFSPQERVQR...PLHYALIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVRIQNENQTLASITF.QNYFRLYEKLAGMTGTADTEAFEFQ
DSQ  ctgacaAAAGTATTTGGTAGTCGCAACGAC...------------CGTACCCTTAAAGGG...TTACAAAAAGTAGTTAATAAGATTAATGCGCTTGAAGCCGATTATGAAAAGTTAACCGATGAGCAGCTTAAAGCGAAAACCGCAGAGTTTCGTGAGCGTTTGGCGGCAGGTGCT........................TCGTTAGATAGCATCATGGCTGAAGCGTTTGCGACGGTGCGTGAAGCGTCAAAGCGTGTGTTCGAAATGCGTCATTTCGACGTGCAGTTACTTGGTGGTATGGTGCTTGATAGTAACCGCATCGCTGAAATGCGTACAGGTGAAGGTAAAACCTTAACCGCAACATTACCTGCTTACCTTAATGCTTTGACGGGCAAAGGTGTTCACGTCATTACCGTCAACGATTACTTGGCGCGCCGTGACGCGGAAAACAACCGTCCATTGTTCGAATTCTTAGGTCTGACG...............GTCGGTATTAACGTT...............GCCGGTCTT...GGCCAGCAA............GATAAA...............AAAGATGCCTATAACGCGGATATCACCTATGGAACCAACAACGAATTTGGTTTCGACTATCTGCGCGATAACATGGCGTTTTCACCACAAGAGCGTGTTCAACGA.........CCATTACACTATGCACTGATCGACGAAGTCGACTCAATCCTTATCGACGAAGCGCGTACACCATTGATTATCTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAAGGCGTTCGTATTCAAAACGAAAACCAAACACTGGCTTCGATTACCTTC...CAAAATTACTTCCGCTTATACGAAAAATTAGCGGGTATGACGGGTACTGCCGACACAGAAGCGTTTGAGTTTCAA
TRN  11011101101011000
NAM  SECA_ECOLI/6-402
ASQ  ltKVFGSRND.----RTLRR.MRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGE........VLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLT.....VGINL.....PGM.PAP....AK.....REAYAADITYGTNNEYGFDYLRDNMAFSPEERVQR...KLHYALVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVQIQNENQTLASITF.QNYFRLYEKLAGMTGTADTEAFEFS
DSQ  ttaactAAAGTTTTCGGTAGTCGTAACGAT...------------CGCACCCTGCGCCGG...ATGCGCAAAGTGGTCAACATCATCAATGCCATGGAACCGGAGATGGAAAAACTCTCCGACGAAGAACTGAAAGGGAAAACCGCAGAGTTTCGTGCACGTCTGGAAAAAGGCGAA........................GTGCTGGAAAATCTGATCCCGGAAGCTTTCGCCGTGGTACGTGAGGCAAGTAAGCGCGTCTTTGGTATGCGTCACTTCGACGTTCAGTTACTCGGCGGTATGGTTCTTAACGAACGCTGCATCGCCGAAATGCGTACCGGTGAAGGAAAAACCCTGACCGCAACGCTGCCTGCTTACCTGAACGCACTAACCGGTAAAGGCGTGCACGTAGTTACCGTCAACGACTACCTGGCGCAACGTGACGCCGAAAACAACCGTCCGCTGTTTGAATTCCTTGGCCTGACT...............GTCGGTATCAACCTG...............CCGGGCATG...CCAGCACCG............GCAAAG...............CGCGAAGCTTACGCAGCTGACATCACTTACGGTACGAACAACGAATACGGCTTTGACTACCTGCGCGACAACATGGCGTTCAGCCCTGAAGAACGTGTACAGCGT.........AAACTGCACTATGCGCTGGTGGACGAAGTGGACTCCATCCTGATCGATGAAGCGCGTACACCGCTGATCATTTCCGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCGAAAGAAGGTGTGCAGATCCAGAACGAAAACCAAACGCTGGCTTCGATCACCTTC...CAGAACTACTTCCGTCTGTATGAAAAACTGGCGGGGATGACCGGTACTGCTGATACCGAAGCTTTCGAATTTAGC
TRN  11011101101011010
NAM  O87123_VIBAL/6-402
ASQ  ltKVIGSRND.----RTLRR.LRKIVKEINNYEPTFEALSDEELKAKTVEFRERLEKGE........TLDKLLPEAFATVREASKRVYGMRHFDVQLIGGMVLNAGQIAEMRTGEGKTLTATLPAYLNALAGKGVHIVTVNDYLAKRDAETNRPLFEFLGMT.....VGVNV.....PNM.PPQ....EK.....R-AYQADILYGTNNEFGFDYLRDNMAFRSEDRVQR...DRFFAVVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKIQNENQTLASITF.QNYFRLYEKLSGMTGTADTEAFEFQ
DSQ  ctgacaAAAGTGATTGGCAGTCGCAACGAC...------------CGAACACTGCGCCGC...CTTAGAAAAATTGTAAAAGAAATTAATAACTACGAGCCAACATTCGAAGCTCTAAGTGATGAAGAGTTAAAAGCAAAGACGGTTGAGTTCCGTGAGCGCCTAGAGAAAGGTGAA........................ACTCTTGATAAACTACTTCCTGAAGCTTTTGCTACGGTTCGTGAAGCATCTAAGCGTGTCTACGGCATGCGTCACTTCGACGTTCAGCTTATCGGTGGTATGGTTCTAAATGCGGGTCAAATTGCGGAGATGCGTACAGGTGAAGGTAAAACGCTGACTGCAACGCTTCCTGCTTACTTAAATGCTCTTGCTGGTAAAGGCGTTCACATCGTAACAGTGAACGATTATCTTGCTAAACGTGATGCTGAGACGAACCGCCCTCTATTTGAATTTTTAGGTATGACC...............GTTGGCGTAAACGTG...............CCAAACATG...CCTCCTCAA............GAGAAA...............AGA---GCGTACCAAGCTGACATTCTATACGGAACCAACAATGAATTTGGTTTTGACTACCTTCGTGACAATATGGCTTTCCGTAGCGAAGACCGTGTACAGCGT.........GATCGCTTCTTTGCAGTTGTCGATGAGGTGGACTCAATCCTAATTGATGAAGCTCGTACTCCTTTGATCATTTCAGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCGAAAGAAGGCGTTAAGATCCAAAACGAAAACCAAACTTTGGCTTCTATTACCTTC...CAGAACTACTTCCGTTTATACGAAAAACTGTCAGGTATGACAGGTACAGCGGATACTGAAGCGTTCGAATTCCAG
TRN  10010101100011000
NAM  SECA_HAEIN/4-400
ASQ  ltRIFGSRNE.----RVLRK.LKKQVVKINKMEPAFEALSDDELKAKTQEFRDRLSGGE........TLQQILPEAFATVREASKRVLGMRHFDVQLIGGMVLTNRCIAEMRTGEGKTLTATLPCYLIALEGKGVHVVTVNDYLARRDAETNRPLFEFLGMS.....VGVNI.....PGL.SPE....EK.....RAAYAADITYATNSELGFDYLRDNLAHSKEERFQR...TLGYALVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVDVKSENQTVASISY.QNYFRLYERLAGMTGTADTEAFEFQ
DSQ  ttaacaAGAATTTTTGGTAGTCGTAATGAA...------------CGCGTTTTACGTAAA...TTAAAAAAACAAGTCGTAAAAATTAATAAAATGGAGCCTGCTTTTGAGGCATTAAGTGATGATGAATTAAAAGCAAAAACACAAGAGTTTCGTGATCGTTTAAGTGGTGGCGAA........................ACTTTGCAACAAATTTTACCAGAAGCATTCGCAACGGTACGCGAAGCAAGTAAGCGTGTGCTTGGTATGCGCCATTTTGATGTTCAGCTTATCGGTGGGATGGTATTGACTAACCGCTGTATCGCAGAAATGCGTACTGGTGAAGGTAAAACATTAACGGCGACTTTGCCTTGTTATTTAATCGCACTTGAAGGTAAAGGCGTTCACGTGGTAACCGTGAATGATTATCTTGCTCGCCGAGATGCAGAAACAAACCGTCCGTTATTTGAATTTTTAGGCATGAGT...............GTAGGCGTCAATATT...............CCTGGTTTA...TCGCCAGAA............GAAAAA...............CGTGCAGCTTATGCGGCAGATATTACTTATGCAACCAATAGTGAACTTGGTTTTGATTATTTACGTGACAACTTAGCCCACTCAAAAGAAGAGCGTTTCCAACGT.........ACTTTAGGCTATGCGTTGGTGGATGAAGTGGATTCTATCTTAATCGATGAAGCGCGTACGCCATTGATTATTTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGGGTGGATGTTAAGAGCGAAAACCAAACTGTTGCATCAATTTCTTAC...CAAAACTACTTCCGTTTATATGAACGTCTTGCGGGTATGACGGGGACTGCGGATACCGAAGCATTTGAGTTCCAA
TRN  10010101110011000
NAM  Q8D301_WIGBR/6-402
ASQ  fgKIFKNSND.----RALKV.INLIVKKINSLESTIEKLTDQQLSSKTIEFKNRISDGD........NLNNILPEAYAVVREASKRIFNMRHFDVQLMGGIVLNRRCIAEMSTGEGKTLTSVLPAYLHSLLGKGVHIVTVNDYLAKRDANNNKPLFEFLGIT.....VGINL.....PGL.NNI....EK.....RNAYLADITYGTNNEYGFDYLRDNMIFNENEKVQR...NLYFALVDEVDSILIDESRTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEKVNINNENQTLASITF.QNYFRLYEKLSGMTGTAYTEAAEFK
DSQ  tttggtAAAATTTTTAAAAATTCTAATGAT...------------CGTGCTCTAAAAGTA...ATTAATTTAATTGTAAAAAAAATAAACAGTCTAGAATCTACAATAGAAAAATTAACTGATCAGCAGTTATCTAGCAAAACAATAGAATTTAAAAATAGGATTTCAGATGGTGAT........................AATTTAAATAACATATTGCCTGAAGCATATGCTGTTGTGAGAGAAGCGAGTAAAAGAATTTTTAATATGAGACATTTTGATGTCCAGTTAATGGGAGGTATAGTTTTAAATCGTAGATGTATAGCAGAAATGAGCACAGGTGAAGGAAAAACATTAACTTCTGTTCTTCCTGCTTATTTACATTCTCTTTTGGGAAAAGGTGTTCATATAGTTACAGTTAATGATTATTTAGCAAAAAGAGATGCAAATAACAATAAACCTTTGTTTGAATTTTTAGGAATAACT...............GTAGGAATAAATTTG...............CCTGGATTA...AATAATATA............GAAAAA...............AGAAACGCTTATTTAGCAGATATTACTTATGGAACAAATAATGAATATGGATTTGATTATTTAAGAGATAATATGATATTTAATGAAAATGAGAAAGTTCAAAGA.........AATTTATATTTTGCTCTAGTGGATGAAGTAGATTCAATTTTAATTGATGAATCTCGAACTCCATTAATTATTTCTGGG...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAAAAGTTAATATTAATAACGAAAATCAAACTTTAGCTTCAATTACATTT...CAAAATTATTTCAGATTGTATGAAAAATTGTCTGGAATGACAGGAACTGCATATACAGAAGCAGCAGAATTTAAA
TRN  10010101110011000
NAM  SECA_BUCBP/6-402
ASQ  lkKLFSDRND.----RILQN.IQTVISKINSMEKFFEKLSDLELKRNTTRFCYRLNNGE........TLDQLLPESFATVREASKRVFGMRHFDVQLIGGIILHQRCIAEMRTGEGKTLTATLPAYLNALQRKGVHIVTMNDYLAKRDAEKNRLLFNFLGLT.....VGINI.....SGL.SSK....LK.....KQAYNADITYGTNNEYGFDYLRDNMVFCREDKVQR...ELNYALLDEVDSILIDESRTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLKIRSENQTLASITF.QNYFRLYKKLSGMTGTAITEAFEFR
DSQ  ttaaaaAAATTATTTAGCGATCGCAATGAT...------------AGAATATTACAAAAT...ATTCAAACGGTTATATCTAAAATTAATAGTATGGAAAAATTTTTCGAAAAACTATCAGATTTAGAATTAAAGAGAAATACCACTCGATTTTGTTACCGTTTAAATAATGGAGAA........................ACATTAGATCAATTGCTACCCGAATCTTTTGCTACTGTGAGAGAAGCAAGTAAACGTGTTTTTGGAATGCGCCATTTTGATGTCCAATTAATTGGAGGAATAATTTTGCATCAAAGATGTATTGCAGAAATGCGTACTGGTGAAGGGAAAACGTTAACAGCAACTTTACCTGCATATTTAAATGCTTTGCAACGTAAGGGTGTTCATATTGTAACTATGAATGATTATTTGGCTAAACGAGATGCCGAAAAAAACAGATTATTATTTAATTTTTTAGGTCTAACT...............GTAGGAATTAATATT...............TCTGGATTA...TCTTCTAAA............TTAAAG...............AAGCAAGCATATAATGCAGATATAACTTATGGAACTAATAATGAGTATGGTTTTGATTATCTTCGAGATAACATGGTTTTTTGTCGAGAAGATAAAGTACAAAGG.........GAATTAAATTATGCGTTGTTAGATGAAGTAGATTCTATTTTGATTGATGAGTCTCGAACACCTTTGGTGATTTCAGGG...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGTTTAAAAATACGAAGTGAAAACCAAACATTGGCGTCAATTACTTTT...CAGAATTATTTTCGTTTATATAAAAAATTGTCAGGTATGACTGGTACAGCTATAACTGAAGCATTTGAATTTCGT
TRN  10010101110011000
NAM  SECA_RHOCA/8-392
ASQ  grKLFGTPND.----RKVKR.TRPLVAKINALEPAFEKLSDAEIVAKTRELQARAQAGE........SLDALLVEAFANCREAARRALGLRAFDTQLMGGIFLHQGNIAEMKTGEGKTLVATFPAYLNALAGKGVHIVTVNDYLARRDSEWMGKVYRHLGLT.....CGVVY.....PFQ.PDD....EK.....RAAYGADITYATNNELGFDYLRDNMKSSVAEMYQR...DHFFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKERVTIQPENVTLASVTF.QNYFRLYEKLAGMTGTAVTEAEEFG
DSQ  ggaagaAAGCTCTTCGGCACGCCCAACGAC...------------CGCAAGGTCAAGCGC...ACGCGTCCGCTGGTGGCGAAGATCAACGCGCTGGAACCGGCCTTCGAAAAGCTCTCCGATGCCGAGATCGTGGCGAAAACCCGCGAGCTGCAGGCCCGCGCGCAAGCGGGCGAA........................AGCCTCGATGCGCTGCTGGTCGAGGCCTTTGCCAACTGCCGCGAGGCCGCCCGCCGGGCGCTTGGCCTTCGCGCCTTCGACACCCAGCTGATGGGCGGGATCTTCCTGCATCAGGGCAACATTGCGGAAATGAAGACCGGCGAGGGCAAGACCCTTGTCGCCACCTTTCCGGCCTATCTGAACGCGCTGGCGGGCAAGGGCGTGCATATCGTCACGGTGAACGATTATCTGGCCCGGCGCGACTCGGAATGGATGGGCAAGGTCTATCGCCATCTGGGTCTGACC...............TGCGGCGTCGTCTAT...............CCGTTCCAG...CCCGATGAT............GAAAAA...............CGCGCCGCCTATGGTGCCGACATCACCTATGCGACGAACAACGAGCTGGGCTTCGATTATCTGCGCGACAACATGAAATCCTCGGTCGCGGAAATGTATCAGCGC.........GATCACTTCTTCGCCATCGTCGACGAGGTGGACAGCATCCTGATCGACGAGGCGCGCACGCCGCTGATCATCTCGGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCGAAGGAACGGGTGACGATCCAGCCCGAAAACGTCACGCTGGCCTCGGTGACCTTC...CAGAACTACTTCCGGCTTTACGAAAAGCTGGCGGGGATGACCGGCACCGCGGTGACCGAAGCCGAGGAATTCGGC
TRN  10010101100011011
NAM  SECA_CAUCR/5-392
ASQ  akKLFGSSNE.----RKVKT.LATRVAKINAYEAEYAALSDEALKGKTAEFKARLEKGE........TLDDILNEAFAVVREASKRVLGMRHFDVQMVGGMVLHFSGISEMRTGEGKTLVATLPTYLNALEGKGVHVITVNDYLARRDADWMGQVYNFLGLS.....YGVIV.....NGL.SQG....ER.....QRAYRSDITYGTNNEFGFDYLRDNLVYSVDEMVQR...GHNFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGADIQPENQTLASVTI.QNYFRLYKKLSGMTGTASTEAQEFD
DSQ  gccaaaAAGCTCTTCGGCTCTTCCAACGAA...------------CGCAAGGTCAAGACC...CTGGCCACGCGCGTGGCCAAGATCAACGCCTATGAAGCCGAATACGCCGCCCTCTCCGACGAGGCGCTGAAGGGCAAGACGGCCGAGTTCAAGGCGCGTCTGGAAAAGGGCGAG........................ACCCTCGACGACATTCTCAACGAAGCCTTCGCCGTGGTGCGCGAGGCCTCCAAGCGCGTGCTGGGCATGCGCCACTTCGACGTCCAGATGGTGGGCGGCATGGTGCTGCACTTCTCGGGCATCTCGGAGATGCGCACCGGTGAAGGCAAGACCCTGGTCGCCACCCTGCCGACCTATCTGAACGCCCTGGAAGGCAAGGGCGTCCACGTCATCACCGTCAACGACTATCTGGCCCGCCGCGACGCCGACTGGATGGGTCAGGTCTACAACTTCCTGGGCCTGAGC...............TACGGCGTCATCGTC...............AACGGCCTG...AGCCAAGGC............GAGCGT...............CAGCGCGCCTATCGCAGCGACATCACCTACGGCACCAACAACGAATTCGGCTTCGACTATCTGCGCGACAACCTCGTCTACAGCGTCGACGAGATGGTCCAGCGC.........GGCCACAACTTCGCGATCGTCGACGAAGTGGACTCGATCCTGATCGACGAGGCCCGCACGCCGCTGATCATCTCGGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAAGGCGCCGACATCCAGCCCGAGAACCAGACCCTGGCCTCGGTGACCATC...CAGAACTACTTCCGCCTCTACAAGAAGCTGTCGGGCATGACCGGCACCGCGTCGACCGAGGCCCAGGAATTCGAC
TRN  11011101101011011
NAM  Q8UA54_AGRT5/8-391
ASQ  arKLFGSANE.----RRVRS.YKSKIAAINALEEATKALSDEALAAKTAEFRQQLADGK........TLDDLLIPAFAVAREASRRVLHMRPFDVQLTGAMILHGGAIAEMKTGEGKTLVATLAVYLNALAGKGVHVVTVNDYLAKRDAATMSKLYGFLGLT.....TGVIV.....HGL.DDD....QR.....REAYACDITYATNNELGFDYLRDNMKYDRAQMVQR...GHNYAIVDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEKVQIQPENQTLSSVTF.QNYFRMYEKLAGMTGTASTEAEEFG
DSQ  gcccgcAAGTTGTTCGGTTCGGCAAATGAA...------------CGCCGCGTCCGCTCC...TATAAAAGCAAGATCGCAGCCATCAATGCGCTGGAAGAGGCCACCAAGGCGCTCTCCGACGAAGCGCTGGCGGCCAAGACCGCGGAATTCCGCCAACAGCTTGCCGACGGCAAG........................ACGCTGGACGATCTGCTGATCCCGGCTTTCGCCGTCGCTCGCGAGGCATCGCGCCGCGTTCTGCACATGCGCCCGTTCGACGTGCAGCTGACCGGCGCCATGATTCTGCATGGCGGCGCCATTGCCGAAATGAAGACCGGTGAAGGCAAGACGCTGGTGGCGACCCTTGCGGTCTACCTCAACGCACTCGCCGGCAAGGGCGTGCATGTCGTCACCGTCAACGACTATCTCGCCAAGCGCGACGCCGCCACGATGAGCAAGCTCTACGGCTTCCTCGGGCTGACG...............ACCGGCGTGATCGTC...............CACGGTTTG...GACGACGAC............CAGCGC...............CGCGAGGCTTATGCCTGCGACATCACCTACGCGACGAATAACGAACTCGGCTTCGATTATCTGCGCGATAACATGAAATATGATCGCGCCCAGATGGTGCAGCGC.........GGCCACAACTACGCGATCGTCGACGAAGTCGACTCGATCCTCGTCGATGAAGCGCGCACGCCGCTTATCATCTCCGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAAAAGGTGCAGATCCAGCCGGAAAACCAGACGCTGTCCTCCGTCACCTTC...CAGAACTATTTCCGCATGTATGAAAAGCTGGCCGGCATGACCGGCACGGCATCGACGGAAGCGGAAGAATTCGGC
TRN  11011101101011011
NAM  Q8FYD8_BRUSU/8-391
ASQ  arKIFGSSND.----RRVKT.LRQRAEQITALEKNYENLTDEQLQAKTAEFRAALAEGK........SLDSLLPDAFATAREAAKRVLGMRPFDVQLIGGMVLHERGIAEMRTGEGKTLMATLPVYLNALEGKGVHVVTVNDYLATRDAETMGRLYNFLGLT.....VGVIK.....HGL.DDD....ER.....RAAYACDITYGTNNELGFDYLRDNMKYERAQMVQR...PHNYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVTIQPENQTLASITF.QNYFRMYNKLSGMTGTAATEAEEFG
DSQ  gcccgcAAGATATTCGGTTCATCCAATGAC...------------CGCCGCGTAAAAACC...CTGCGCCAGCGGGCAGAACAGATTACTGCTCTCGAGAAGAACTACGAGAATCTGACCGACGAGCAGCTTCAGGCCAAGACCGCCGAATTCCGGGCGGCGCTGGCTGAGGGCAAA........................TCTCTCGATTCCCTTCTGCCTGACGCTTTCGCCACCGCGCGCGAAGCTGCCAAGCGCGTGCTCGGTATGCGCCCGTTCGACGTGCAGCTCATCGGCGGCATGGTTCTGCATGAACGCGGCATCGCCGAAATGCGCACCGGTGAAGGCAAGACGCTGATGGCGACGCTGCCGGTCTATCTCAACGCGCTTGAAGGCAAGGGCGTGCATGTCGTGACCGTCAACGACTACCTCGCCACCCGCGATGCCGAAACCATGGGCCGTCTCTATAATTTCCTCGGCCTGACT...............GTCGGCGTCATCAAG...............CACGGTCTC...GACGATGAT............GAGCGC...............CGCGCGGCCTATGCCTGCGACATCACCTACGGCACCAATAACGAGCTTGGCTTCGATTATCTGCGCGATAACATGAAGTATGAGCGCGCGCAGATGGTGCAGCGC.........CCGCATAATTACGCCATCGTCGACGAAGTGGATTCGATCCTCATCGACGAAGCGCGCACGCCGCTCATCATTTCCGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAACATGTGACCATCCAGCCGGAAAACCAGACGCTGGCCTCGATCACCTTC...CAGAACTATTTCCGCATGTACAACAAGCTGTCGGGCATGACCGGCACGGCTGCAACCGAAGCGGAAGAATTCGGC
TRN  10010101100011001
NAM  Q89XV1_BRAJA/6-389
ASQ  arKFFGSAND.----RRVKG.YQSRVNAINALEPELIKLSDEELKARTADFKKQLAEGK........TLDDLLVPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKTGEGKTLVATLAVYLNALAGKGVHVVTVNDYLARRDSGWMGQIYGFLGMT.....TGVIV.....HGL.DDA....ER.....KTAYACDITYGTNNEYGFDYLRDNMKYRLEDMVQR...PHFFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVQVQPENQTLASITF.QNYFRMYEKLAGMTGTAATEADELF
DSQ  gcccgcAAGTTTTTCGGCTCCGCCAACGAC...------------CGGCGGGTGAAGGGA...TATCAGTCCCGCGTCAACGCGATCAACGCGCTGGAGCCCGAGCTCATCAAGCTCTCCGACGAGGAGCTCAAGGCCCGCACGGCCGACTTCAAGAAGCAGCTCGCCGAGGGCAAG........................ACGCTCGATGACCTGCTGGTGCCGGCCTTCGCGACCGTGCGCGAGGCCGCCAAGCGCACGCTCGGCCAGCGCCATTTCGACGTCCAGCTGATCGGCGGCATGGTGCTGCACGAGGGCGACATCGCCGAGATGAAGACCGGCGAAGGCAAGACGCTGGTGGCGACGCTTGCGGTCTATCTCAACGCGCTCGCCGGCAAGGGCGTCCATGTCGTCACCGTCAACGACTACCTCGCCCGCCGCGACTCCGGCTGGATGGGCCAGATCTACGGCTTCCTCGGCATGACC...............ACGGGCGTGATCGTC...............CACGGTCTC...GACGATGCC............GAGCGC...............AAGACGGCCTATGCCTGCGACATCACCTACGGCACCAACAACGAATACGGCTTCGACTATCTGCGCGACAACATGAAGTACCGGCTCGAGGACATGGTCCAGCGG.........CCGCACTTCTTCGCCATCGTCGACGAAGTCGACTCCATCCTGATCGACGAAGCGCGCACGCCGCTGATCATCTCCGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAGCACGTCCAGGTCCAGCCCGAGAACCAGACGCTGGCCTCGATCACCTTC...CAGAACTACTTCCGCATGTACGAGAAGCTTGCGGGCATGACCGGCACCGCCGCGACCGAAGCGGACGAACTGTTC
TRN  11011111101111111
NAM  Q92H92_RICCN/5-389
ASQ  lkKLFGTAND.----RTVKK.LFSEITKINSLEPAIQKLSDEELKNKTVEFKEKLKNGA........TLDDIVYEAFAVVREAAKRVCGMRHFDVQLIGGLILHRGMITEMRTGEGKTLVATLPAYLNALTGKGVHVVTVNDYLARRDSASMGKIYNFLGLS.....VGCIV.....GGM.PDE....VK.....RAAYNADITHATNNELGFDYLRDNMKYSLQERVLR...PFNFAIIDEVDSILIDEARTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVKIQNENQTLASITF.QNYFRNYPKLSGMTGTAMTEAPELK
DSQ  ttaaaaAAACTTTTCGGTACTGCAAATGAT...------------CGTACTGTAAAAAAA...CTATTTTCTGAAATTACAAAAATTAACTCGCTTGAACCTGCTATACAAAAATTATCAGATGAGGAGTTGAAGAATAAAACTGTGGAGTTTAAAGAAAAGCTTAAAAACGGAGCT........................ACTTTAGATGATATAGTATATGAGGCGTTTGCGGTAGTTAGGGAAGCAGCTAAAAGAGTTTGCGGTATGCGTCATTTTGACGTTCAGCTTATAGGTGGCCTGATATTACATCGAGGCATGATTACCGAAATGCGTACCGGTGAGGGTAAGACCTTAGTTGCAACGCTTCCTGCTTACTTAAATGCTTTAACTGGAAAAGGTGTACATGTTGTAACCGTAAATGATTATCTAGCACGCCGTGATTCTGCTTCCATGGGTAAAATTTACAATTTTTTAGGTTTATCG...............GTTGGATGTATTGTT...............GGCGGTATG...CCTGATGAG............GTAAAA...............CGAGCCGCCTATAACGCCGATATTACTCATGCAACAAATAATGAACTCGGTTTCGATTATTTAAGGGATAATATGAAGTATAGCTTGCAGGAGCGGGTACTTCGT.........CCTTTTAATTTTGCTATCATCGATGAGGTTGATTCGATTTTGATAGATGAAGCAAGAACTCCGCTCGTTATCTCGGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAAATGTGAAAATTCAAAATGAGAACCAAACTTTAGCATCTATTACTTTC...CAAAATTATTTTCGTAATTATCCTAAATTATCGGGTATGACCGGTACGGCTATGACCGAAGCACCGGAACTAAAA
TRN  10010101100011000
NAM  Q8F4S9_LEPIN/8-386
ASQ  lrVVFGSKFE.----RDLKK.LIPIVRQINSLEESIKGMDDSTLSSQTKKFKERIVQGE........SLDSILPEAFATVREVSLRTMGMRHFDVQMMGGIALHGGNISEMKTGEGKTLTSTLAVYLNSLAGNGVHVVTVNDYLAKRDANWMKPIYDFLGIS.....VGVIQ.....HDM.DHE....QR.....KVAYAADITYGTNNEFGFDYLRDNMVSHKDHKVQR...SHFFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVTIAKESQTLASITF.QNYFRMYDKLAGMTGTADTEAEEFK
DSQ  ctccggGTGGTTTTCGGAAGTAAATTTGAG...------------AGAGATTTAAAAAAA...CTCATCCCAATCGTTAGACAAATTAATTCTTTAGAGGAAAGTATAAAGGGAATGGACGATTCCACTCTTTCTTCTCAAACGAAAAAGTTTAAAGAAAGAATTGTACAAGGAGAA........................TCCTTAGATTCAATTCTTCCAGAGGCATTTGCCACAGTAAGAGAAGTTTCTCTTCGTACAATGGGGATGAGACATTTTGACGTGCAGATGATGGGCGGAATCGCTCTGCATGGTGGAAACATCTCCGAAATGAAAACTGGAGAAGGAAAAACTCTTACCTCTACTCTTGCAGTTTATCTCAATTCTCTTGCGGGAAATGGTGTACACGTTGTTACAGTAAACGATTACCTTGCCAAAAGAGACGCGAATTGGATGAAACCAATTTATGACTTTTTAGGGATTTCA...............GTCGGTGTAATTCAA...............CACGATATG...GATCATGAA............CAAAGA...............AAGGTGGCTTACGCCGCAGACATCACCTATGGAACCAACAACGAATTCGGTTTTGATTATTTAAGAGACAATATGGTTTCTCATAAGGATCATAAGGTTCAGAGA.........TCTCATTTTTTTGCGATCGTAGACGAGGTGGATTCAATTTTAATTGATGAAGCAAGAACTCCTTTGATCATTTCCGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAAGAAAACGTTACAATCGCAAAAGAATCTCAAACTCTCGCTTCTATCACATTC...CAAAATTATTTTAGAATGTACGATAAGCTTGCCGGAATGACTGGAACCGCGGACACCGAAGCGGAGGAATTTAAA
TRN  10010101100011000
NAM  Q898W1_CLOTE/9-387
ASQ  weKIFGTYS-.---QRELKR.VIPIVDKIDKLDQTMQKLTDEELKNKTNEFKERLSKGE........TLDDILVEAFAVAREAAWRVVKLKPYREQLIGGIILHQGRIAEMKTGEGKTLVATLPAYLNALKGEGVHIVTVNDYLAKRDKETMGAIYEFLGLT.....VGVIL.....HDL.EHN....ER.....QEAYNCDITYGTNSELGFDYLRDNMVVYKEERVQR...KLNFSIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVNVERESKTLATITY.QNFFRMYDKLSGMTGTAQTEEVEFR
DSQ  tgggaaAAAATATTTGGCACATATAGT---...---------CAAAGAGAACTTAAAAGA...GTAATTCCAATAGTAGATAAAATAGATAAATTAGACCAAACCATGCAGAAGTTAACAGATGAAGAGTTAAAAAATAAAACAAATGAATTTAAAGAAAGATTATCAAAAGGAGAA........................ACCTTAGATGATATATTAGTAGAAGCTTTTGCAGTAGCAAGAGAAGCTGCGTGGAGAGTTGTTAAATTAAAACCTTACAGAGAACAACTAATAGGTGGTATAATTTTGCACCAAGGTAGAATTGCAGAAATGAAAACAGGAGAAGGAAAAACATTAGTTGCAACATTACCAGCATATCTCAATGCTCTAAAAGGAGAAGGCGTACATATAGTTACAGTAAATGATTATCTTGCAAAAAGAGATAAAGAAACTATGGGAGCTATATATGAATTCTTAGGGTTAACT...............GTAGGGGTTATCCTC...............CACGATTTA...GAGCATAAC............GAAAGA...............CAAGAAGCATATAATTGTGATATTACTTATGGAACCAATAGTGAACTTGGATTTGATTATTTAAGAGATAATATGGTTGTTTATAAAGAAGAGAGAGTTCAAAGG.........AAATTAAACTTTTCCATAGTAGACGAAGTGGATTCCATACTAATAGACGAAGCGAGAACTCCTCTTATAATATCAGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAAGGCGTAAATGTAGAAAGAGAATCAAAAACTCTAGCAACTATAACTTAT...CAAAATTTCTTTAGAATGTATGATAAATTATCTGGTATGACAGGTACAGCACAAACAGAAGAAGTAGAATTTAGA
TRN  10010101110011000
NAM  Q97F94_CLOAB/4-382
ASQ  leKIFGTYSD.----REVKR.IIPLVDKIDALDGSMQALSEDELKAKTAEFKQRYENGE........TLDDLLVEAFAVVREASSRILGLKHFREQIIGGIVLHQGRISEMKTGEGKTLVATLPSYLNAITGKGVHVVTVNDYLAKRDMEWMGQLYQYLGLT.....TGVIV.....HDL.DQK....QR.....QEAYAADITYGTNNEFGFDYLRDNMVIYKEERVQR...PLHFCIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKVQKESKTLATITF.QNYFRMYEKLSGMTGTALTEEVEFR
DSQ  ttagagAAAATATTTGGTACATATAGTGAT...------------AGAGAAGTGAAAAGG...ATTATTCCTCTTGTTGATAAAATAGATGCACTAGATGGATCAATGCAAGCTTTAAGTGAGGATGAACTTAAAGCTAAAACTGCTGAATTTAAGCAGAGGTATGAAAATGGGGAA........................ACACTTGATGATTTACTTGTTGAAGCATTTGCGGTGGTAAGAGAAGCTTCATCAAGAATTCTTGGCTTAAAGCATTTTAGAGAGCAAATTATAGGTGGTATTGTACTTCATCAGGGAAGAATTTCAGAGATGAAAACCGGTGAAGGTAAAACATTAGTTGCAACACTTCCGTCATATTTGAATGCAATTACAGGTAAGGGAGTTCATGTAGTAACAGTAAATGATTACCTTGCAAAAAGAGATATGGAATGGATGGGACAGCTTTATCAATATCTTGGATTAACT...............ACAGGGGTAATAGTT...............CATGATCTT...GATCAAAAA............CAAAGA...............CAGGAAGCTTATGCAGCAGATATAACCTACGGTACAAATAACGAGTTTGGATTTGATTATTTAAGAGATAACATGGTTATATATAAGGAAGAAAGAGTTCAAAGA.........CCACTTCACTTTTGTATAGTTGACGAGGTGGACTCAATCTTAATAGATGAGGCAAGAACACCACTTATAATATCCGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGTGTTAAGGTTCAAAAAGAATCTAAGACACTTGCTACAATAACTTTC...CAGAATTATTTTAGAATGTATGAAAAACTTTCTGGTATGACAGGTACTGCATTAACAGAGGAAGTGGAGTTCAGA
TRN  10010101110011000
NAM  Q8XIF0_CLOPE/4-382
ASQ  fdKIFGSYSD.----REVKR.ITPIVDKIDSLGPEMEKLSDEELKQKTFEFKDRYAKGE........SLDDMLPEAFAVCREASTRVLGMKHYREQLIGGIVLHQGRIAEMKTGEGKTLVATLPVYLNAIAGKGVHVITVNDYLATRDKEWMGQLYEFLGLT.....TGVIV.....HGL.TND....QR.....REAYNADITYGTNNEFGFDYLRDNMVIYKEERVQR...PLHYCIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKVQRESKTLATITF.QNYFRMYTKLAGMTGTALTEETEFR
DSQ  tttgatAAAATATTTGGAAGTTATAGCGAT...------------AGAGAAGTTAAGAGA...ATAACACCTATTGTAGACAAAATAGATTCACTTGGGCCTGAAATGGAAAAACTATCTGATGAAGAATTGAAGCAAAAAACATTTGAATTTAAGGATAGATATGCTAAAGGAGAA........................AGCTTAGATGATATGCTTCCAGAAGCTTTTGCTGTTTGTAGAGAAGCATCAACAAGAGTTTTAGGAATGAAACACTATAGAGAGCAATTAATTGGTGGTATAGTTTTACATCAAGGAAGAATAGCAGAAATGAAAACTGGTGAAGGTAAAACATTAGTTGCTACTTTACCTGTTTATTTAAATGCTATAGCTGGTAAAGGTGTTCATGTAATTACAGTTAATGATTATCTTGCAACAAGAGATAAAGAGTGGATGGGGCAATTATATGAATTCTTAGGATTAACT...............ACTGGGGTTATAGTT...............CATGGATTA...ACTAATGAC............CAAAGA...............AGAGAAGCATATAATGCTGATATAACTTATGGAACAAATAATGAATTTGGATTTGATTATTTAAGAGATAACATGGTTATTTATAAAGAAGAAAGAGTTCAAAGA.........CCGTTACACTACTGTATAGTGGATGAGGTTGACTCAATTCTTATAGATGAAGCAAGAACTCCTCTTATAATTTCAGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAGGAAGGTGTTAAAGTTCAAAGAGAATCTAAGACTTTAGCAACTATAACATTC...CAAAACTATTTCAGAATGTATACTAAATTAGCAGGTATGACAGGTACTGCGCTTACTGAGGAAACTGAATTTAGA
TRN  10010101110011000
NAM  Q8RCB4_THETN/8-386
ASQ  veKIFGSYSE.----REVRR.LEPIAEKVLSYEDQMARLTDAELRAKTDEFKNRLKNGE........TLDDILPEAFAVVREAAWRTLKMKHFKVQIIGGIVLHQGRIAEMKTGEGKTLVATLPAYLNALEGKGVHIVTVNDYLAKRDRDWMGKIYEFLGLS.....VGVIL.....HDM.GPA....ER.....KKAYAADITYGTNNEFGFDYLRDNMVIYKEDMVQR...ELNYAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKVERESKTLATITL.QNYFRMYKKLAGMTGTAQTEEQEFR
DSQ  gttgaaAAAATATTTGGCAGTTACAGTGAA...------------AGAGAAGTAAGGAGA...CTGGAGCCAATTGCGGAGAAAGTTTTGTCATATGAAGACCAGATGGCAAGGCTTACTGATGCGGAGTTAAGGGCGAAGACAGATGAGTTTAAAAATAGATTGAAAAACGGTGAA........................ACCCTTGATGATATACTTCCTGAAGCTTTTGCAGTTGTGAGAGAGGCTGCCTGGAGAACATTAAAGATGAAGCACTTCAAGGTACAGATAATAGGTGGCATTGTCCTTCACCAGGGGCGTATTGCCGAGATGAAGACTGGTGAAGGTAAGACATTGGTGGCTACTCTGCCCGCATATCTTAATGCTTTGGAAGGAAAAGGAGTTCACATTGTAACTGTCAATGACTACTTGGCTAAAAGAGATAGAGATTGGATGGGGAAGATATACGAATTTTTGGGGTTAAGT...............GTGGGAGTAATACTT...............CACGACATG...GGACCTGCA............GAGAGA...............AAGAAAGCCTATGCAGCTGATATAACCTATGGTACAAACAATGAATTTGGCTTTGACTACTTGAGAGACAACATGGTCATATACAAAGAAGATATGGTTCAAAGA.........GAGCTCAATTATGCCATAATAGACGAGGTAGACAGCATACTGATAGATGAAGCCAGAACTCCTCTCATAATCTCTGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAGGGAGTAAAAGTTGAAAGGGAAAGTAAAACCCTTGCTACTATAACTTTA...CAAAATTATTTCAGGATGTACAAAAAATTAGCCGGTATGACAGGTACTGCTCAGACAGAAGAGCAGGAATTCAGA
TRN  10010101100011000
NAM  Q8GDT1_HELMO/5-380
ASQ  lkKLLDDNA-.----KEVRK.LKKIVDQINSWEPEFTRLDDAALQYKTVEFRQRIENGE........SLDSLLPEAFATVREASKRVTGMRHFDVQLIGGMVLHQGRIAEMKTGEGKTLVATLPSYLNGLTGRGVHVVTVNDYLARRDSELMGRIHRFLGLK.....VGLIV.....HGL.DFA....ER.....RESYAADITYGTNNEFGFDYLRDNMVNQPHHMVQR...ELNFAIVDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLKIQNESQTLATITL.QNYFRMYNKLSGMTGTARTEEDEFI
DSQ  ttaaagAAATTGCTCGACGATAACGCG---...------------AAAGAAGTTCGTAAG...CTAAAAAAGATCGTCGATCAGATTAACTCGTGGGAGCCTGAATTCACTCGGCTCGACGATGCTGCGCTTCAATACAAAACGGTGGAGTTTCGTCAACGCATTGAGAATGGCGAA........................AGTTTGGACAGCCTCCTTCCGGAAGCCTTCGCTACGGTCCGTGAAGCTTCTAAGCGTGTCACCGGTATGCGCCATTTTGATGTCCAGCTAATCGGCGGAATGGTCCTTCATCAGGGACGTATCGCTGAGATGAAGACCGGGGAAGGGAAAACCCTTGTGGCTACCTTGCCTTCCTATCTGAACGGTTTGACAGGCCGTGGTGTCCACGTCGTTACCGTCAACGACTATTTGGCCCGTCGGGACTCCGAGTTGATGGGCCGTATTCATCGATTCCTCGGACTGAAG...............GTCGGCCTCATTGTC...............CATGGGCTT...GATTTTGCC............GAACGC...............CGGGAATCCTACGCTGCCGATATTACCTACGGCACGAATAATGAGTTCGGTTTTGATTACCTGCGGGACAATATGGTAAACCAGCCTCACCATATGGTCCAGCGG.........GAGCTGAATTTTGCCATCGTCGACGAAGTGGATTCGATCTTGGTCGACGAAGCCCGGACCCCATTGATCATCTCCGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAGGAAGGGCTTAAGATTCAAAACGAGTCTCAAACCTTGGCGACCATCACGCTG...CAAAATTACTTCCGTATGTATAACAAACTGTCCGGTATGACCGGTACGGCTCGGACAGAAGAAGACGAATTCATC
TRN  11011101101011010
NAM  Q8RI93_FUSNN/6-407
ASQ  lkKIFGTKND.----REIKA.LTKEVEKINALESEYEKLSDEDLKNKTNIFKERLKNGE........TLDDILVEAFATVREASKRVLGLRHYDVQLIGGMVLHQGKITEMKTGEGKTLVATCPVYLNALAGHGVHVITVNDYLAKRDRDQMSRLYGFLGLS.....SGVIL.....NGL.PTD....QR.....KKSYNSDITYGTNSEFGFDYLRDNMVSSLDQKVQR...ELNFCIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKIASENQTLATITL.QNYFRMYKKLSGMTGTAETEATEFM
DSQ  ctaaaaAAGATTTTTGGTACTAAGAATGAC...------------AGAGAAATAAAAGCT...CTGACAAAAGAAGTTGAAAAAATCAATGCATTAGAATCTGAATATGAAAAACTTTCAGATGAAGATTTAAAGAACAAAACAAATATTTTTAAAGAAAGATTAAAAAATGGTGAA........................ACTCTTGATGATATTTTAGTTGAAGCATTTGCAACAGTTAGAGAAGCATCAAAGAGAGTTTTAGGTTTAAGACATTATGATGTGCAATTAATTGGGGGTATGGTTCTACACCAAGGAAAAATCACAGAAATGAAAACAGGAGAAGGTAAAACTTTGGTTGCAACTTGTCCAGTTTATTTAAATGCCCTTGCAGGTCATGGTGTACATGTAATTACAGTAAATGACTATTTGGCAAAAAGAGATAGAGACCAAATGTCAAGACTATATGGATTTTTAGGTTTAAGT...............TCAGGAGTTATTTTA...............AATGGATTA...CCAACTGAC............CAAAGA...............AAAAAATCATATAATTCAGATATAACTTATGGTACAAACTCAGAATTTGGATTTGACTATTTAAGAGATAATATGGTATCTAGTTTAGACCAAAAAGTTCAAAGA.........GAACTTAATTTCTGTATAGTGGACGAAGTTGACTCAATACTTATTGATGAAGCAAGAACACCACTAATAATTTCAGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGAGTTAAAATTGCTAGTGAAAACCAAACTCTTGCAACTATAACACTT...CAAAATTATTTTAGAATGTATAAGAAATTATCAGGAATGACTGGTACTGCTGAAACAGAAGCAACAGAATTTATG
TRN  10010101100011000
NAM  Q834A7_ENTFA/5-382
ASQ  lkKMIENDK-.----KELRR.LEKIADKIDAHASAMEQLSDEQLREKTDEFKARYQKGE........TLDELLPEAFAVVREAAKRVLGLFPYRVQLMGGIVLHDGNIPEMRTGEGKTLTATMPVYLNALSGEGVHVVTVNEYLATRDSNEMGELYNFLGLS.....VGLNI.....NSK.SSD....EK.....REAYNCDITYSTNNELGFDYLRDNMVVYRSQMVQR...PLNYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEIEDETKTMATITF.QNYFRMYKKLAGMTGTAKTEEEEFR
DSQ  ttgaaaAAAATGATCGAAAACGATAAA---...------------AAAGAATTAAGACGA...TTAGAAAAAATCGCCGATAAAATTGATGCACATGCAAGTGCAATGGAACAACTAAGCGATGAACAATTACGTGAAAAAACAGATGAATTTAAAGCCCGTTATCAAAAAGGGGAA........................ACCTTAGACGAACTATTACCAGAAGCGTTTGCGGTTGTCCGTGAAGCTGCTAAACGAGTACTAGGTTTATTCCCGTACCGTGTCCAATTAATGGGTGGGATTGTGCTTCATGACGGGAACATTCCTGAAATGAGAACAGGTGAAGGGAAAACCTTGACTGCCACAATGCCTGTATACTTGAATGCACTATCTGGCGAAGGAGTACACGTTGTTACAGTTAATGAATACTTAGCAACCCGTGACTCTAACGAAATGGGAGAATTATATAATTTCTTAGGCTTAAGC...............GTTGGCTTAAACATT...............AACTCTAAA...TCTTCTGAT............GAAAAA...............CGTGAAGCGTATAACTGTGATATCACTTATAGTACAAATAACGAATTAGGATTTGACTATTTGCGTGATAACATGGTTGTTTATCGCAGCCAAATGGTTCAACGT.........CCATTAAACTATGCAATTGTCGATGAAGTGGATTCAATCTTAATTGATGAAGCAAGAACCCCATTAATTATTTCTGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGCGTCGAAATTGAAGATGAAACAAAGACAATGGCGACGATTACGTTC...CAAAACTACTTCCGGATGTACAAAAAACTAGCCGGGATGACTGGTACTGCTAAAACAGAAGAAGAAGAATTCCGT
TRN  10010101110011000
NAM  Q9CJ85_LACLA/5-395
ASQ  irKLVENDK-.----KELKK.LNRMALQVESFADEMEHLTDEQLKAKTPELKERIAKGE........SLDDLLYEAFAVCREAARRVLGLYPFHVQIMGGIVLHNGDVPEMRTGEGKTLTATMPVYLNALSGKGVHVVTVNEYLATRDMTEMGELYSWLGLT.....VGLNL.....NSK.SPE....EK.....REAYNCDITYSTSAELGFDYLRDNMVTRAEDMVQK...PLNYALVDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEAVPIQDESKTMASITI.QNYFRMYKKLSGMTGTAKTEEEEFR
DSQ  attagaAAACTTGTCGAAAACGACAAA---...------------AAAGAGCTCAAAAAA...CTCAATAGAATGGCGCTTCAAGTTGAAAGTTTCGCTGATGAAATGGAACATTTGACTGATGAGCAATTGAAAGCCAAAACACCCGAATTAAAAGAACGTATTGCAAAAGGAGAA........................AGTCTTGATGATCTTCTCTATGAAGCATTTGCTGTCTGTCGTGAAGCAGCCCGCCGTGTGCTTGGCTTATACCCTTTCCACGTTCAAATTATGGGTGGGATTGTCTTACATAATGGTGACGTTCCCGAAATGCGTACTGGTGAAGGTAAAACTTTAACTGCGACAATGCCAGTTTATCTTAACGCTTTGTCAGGTAAAGGCGTTCACGTTGTTACTGTCAATGAATATTTGGCAACACGTGATATGACTGAAATGGGTGAACTTTACAGCTGGCTTGGATTGACT...............GTTGGTTTGAACTTG...............AATTCAAAA...TCACCAGAA............GAAAAA...............CGTGAAGCTTACAACTGTGACATCACTTATTCAACATCAGCTGAGCTTGGCTTTGATTATCTTCGTGATAACATGGTGACACGTGCCGAAGATATGGTTCAAAAG.........CCATTGAACTATGCTCTTGTCGATGAAGTTGACTCAATCTTGGTCGATGAAGCCAGAACACCTTTGATTATTTCTGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAAGCTGTGCCAATTCAAGATGAATCAAAAACAATGGCTTCAATTACGATT...CAAAACTACTTCCGGATGTATAAAAAACTGTCAGGGATGACAGGGACTGCTAAAACCGAAGAAGAAGAATTCCGT
TRN  10010101100011000
NAM  Q8DNT8_STRR6/5-383
ASQ  lkTIIENDKG.-----EIRR.LEKMADKVFKYEDQMAALTDDQLKAKTVEFKERYQNGE........SLDSLLYEAFAVVREGAKRVLGLFPYKVQVMGGIVLHHGDVPEMRTGEGKTLTATMPVYLNALSGKGVHVVTVNEYLSERDATEMGELYSWLGLS.....VGINL.....ATK.SPM....EK.....KEAYECDITYSTNSEIGFDYLRDNMVVRAENMVQR...PLNYALVDEVDSILIDEARTPLIVSGaXXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVPIQDETKTSASITY.QNLFRMYKKLSGMTGTGKTEEEEFR
DSQ  ttaaaaACAATTATCGAAAATGATAAAGGA...---------------GAAATCCGTCGT...CTGGAAAAGATGGCTGACAAGGTTTTCAAATACGAAGACCAAATGGCTGCTTTGACTGACGACCAACTAAAAGCAAAAACAGTTGAATTTAAGGAACGTTATCAAAATGGAGAA........................TCACTGGATTCATTGCTTTACGAAGCATTTGCGGTTGTCCGTGAAGGTGCCAAACGTGTCCTAGGTCTCTTCCCTTATAAGGTTCAGGTCATGGGGGGGATTGTTCTTCACCATGGTGACGTGCCAGAGATGCGTACAGGGGAAGGGAAAACCTTGACTGCGACCATGCCGGTATACCTCAATGCCCTTTCAGGTAAAGGGGTTCACGTAGTTACGGTTAATGAATACCTGTCAGAACGTGACGCGACTGAGATGGGTGAATTGTACTCTTGGCTTGGTTTGTCA...............GTAGGGATTAACTTG...............GCTACCAAA...TCTCCAATG............GAGAAA...............AAAGAAGCCTATGAGTGTGATATTACTTACTCAACTAACTCAGAAATCGGATTTGACTACCTTCGTGACAATATGGTCGTTCGCGCTGAAAATATGGTACAACGT.........CCGCTTAACTATGCCTTGGTCGATGAGGTTGACTCTATCTTGATTGACGAGGCTCGTACACCTTTGATTGTATCAGGTgccXXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAAGAAGGTGTGCCAATCCAGGATGAAACCAAGACATCTGCCTCAATCACGTAC...CAAAACCTTTTCCGTATGTACAAAAAATTGTCTGGTATGACGGGTACAGGTAAGACTGAGGAAGAAGAATTTCGT
TRN  11011101101011000
NAM  Q88YL7_LACPL/5-382
ASQ  lkRWVESDK-.----RTIRR.LDKIANKVEAYADEYGKLSDADLQAKTPEFRERYKEGE........SLDDLLPEAFATAREGAKRVLGLYPFHVQILGGIVLHQGDIAEMKTGEGKTLTATMPVYLNAISGKGVHVVTVNEYLSARDATEMGELYNWLGMS.....VGING.....AEK.SPE....EK.....RAAYNADITYSTNGEIGFDYLRDNMVVYREDMVQR...PLNFAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVEIQEETKTMANITY.QNLFRMYKKLSGMTGTAKTEQEEFR
DSQ  ttaaaaCGCTGGGTTGAAAGCGACAAG---...------------CGGACTATTCGGCGT...CTGGATAAGATTGCTAATAAAGTTGAAGCTTATGCCGACGAATACGGCAAGTTAAGTGATGCTGACTTGCAAGCGAAGACCCCAGAATTTCGTGAACGGTACAAGGAGGGCGAA........................TCGCTCGACGATTTGCTGCCCGAAGCATTTGCAACGGCGCGTGAAGGTGCGAAGCGGGTACTTGGTTTATACCCATTCCACGTTCAAATCCTCGGTGGAATTGTTTTGCATCAAGGTGACATTGCTGAAATGAAGACTGGTGAAGGGAAGACCTTAACGGCCACTATGCCAGTTTATTTGAATGCCATCTCTGGTAAGGGTGTTCACGTTGTAACAGTTAATGAATACTTATCAGCGCGTGATGCGACTGAAATGGGTGAACTGTATAACTGGTTAGGGATGAGC...............GTCGGAATCAACGGG...............GCTGAAAAG...TCGCCTGAA............GAAAAA...............CGTGCCGCTTATAACGCCGATATTACTTATTCGACGAACGGTGAAATTGGGTTCGATTACTTACGTGATAACATGGTGGTCTACCGTGAAGACATGGTGCAACGA.........CCACTTAATTTTGCCATCATTGATGAAGTTGACTCAATCTTAATTGATGAAGCCCGGACACCGTTGATCATTTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAGGAACACGTTGAGATTCAAGAAGAAACCAAGACGATGGCGAATATCACGTAC...CAAAACTTATTCCGGATGTACAAAAAGTTATCTGGGATGACTGGGACGGCCAAGACGGAACAAGAAGAATTCCGC
TRN  11011101101011000
NAM  SECA_BACSU/1-382
ASQ  mlGILNKMF-.DPTKRTLNR.YEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGA........TTDDLLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLT.....VGLNL.....NSM.SKD....EK.....REAYAADITYSTNNELGFDYLRDNMVLYKEQMVQR...PLHFAVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLEIQNESMTLATITF.QNYFRMYEKLAGMTGTAKTEEEEFR
DSQ  atgcttGGAATTTTAAATAAAATGTTT---...GATCCAACAAAACGTACGCTGAATAGA...TACGAAAAAATTGCTAACGATATTGATGCGATTCGCGGAGACTATGAAAATCTCTCTGACGACGCATTGAAACATAAAACAATTGAATTTAAAGAGCGTCTTGAAAAAGGGGCG........................ACAACGGATGATCTTCTTGTTGAAGCTTTCGCTGTTGTTCGAGAAGCTTCACGCCGCGTAACAGGCATGTTTCCGTTTAAAGTCCAGCTCATGGGGGGCGTGGCGCTTCATGACGGAAATATAGCGGAAATGAAAACAGGGGAAGGGAAAACATTAACGTCTACCCTGCCTGTTTATTTAAATGCGTTAACCGGTAAAGGCGTACACGTCGTGACTGTCAACGAATACTTGGCAAGCCGTGACGCTGAGCAAATGGGGAAAATTTTCGAGTTTCTCGGTTTGACT...............GTCGGTTTGAATTTA...............AACTCAATG...TCAAAAGAC............GAAAAA...............CGGGAAGCTTATGCCGCTGATATTACTTACTCCACAAACAACGAGCTTGGCTTCGACTATTTGCGTGACAATATGGTTCTTTATAAAGAGCAGATGGTTCAGCGC.........CCGCTTCATTTTGCGGTAATAGATGAAGTTGACTCTATTTTAATTGATGAAGCAAGAACACCGCTTATCATTTCTGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAGGAAGGGCTTGAGATTCAAAACGAAAGCATGACCTTGGCGACGATTACGTTC...CAAAACTACTTCCGAATGTACGAAAAACTTGCCGGTATGACGGGTACAGCTAAGACAGAGGAAGAAGAATTCCGC
TRN  10010101100011000
NAM  Q815G7_BACCR/1-382
ASQ  miGILKKVF-.DVNQRQIKR.MQKTVEQIDALESSIKPLTDEQLKGKTLEFKERLTKGE........TVDDLLPEAFAVVREAATRVLGMRPYGVQLMGGIALHEGNISEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLAQRDASEMGQLHEFLGLT.....VGINL.....NSM.SRE....EK.....QEAYAADITYSTNNELGFDYLRDNMGLYKEECVQR...PLHFAIIDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEIQNESMTLATITF.QNYFRMYEKLSGMTGTAKTEEEEFR
DSQ  atgatcGGTATTTTAAAAAAGGTGTTT---...GATGTAAATCAACGCCAAATTAAACGT...ATGCAAAAGACAGTTGAGCAAATTGATGCATTAGAGTCATCTATTAAGCCACTAACTGATGAACAATTAAAAGGAAAGACGCTTGAATTTAAAGAACGTCTAACAAAAGGTGAA........................ACAGTAGATGATTTACTACCTGAAGCTTTTGCAGTTGTTCGCGAAGCGGCAACTCGTGTTCTTGGAATGCGTCCATATGGCGTACAGTTAATGGGTGGTATTGCCTTACATGAAGGGAATATTTCTGAGATGAAAACGGGTGAAGGTAAAACGTTAACATCTACATTACCTGTATATTTAAATGCTTTAACAGGAAAAGGTGTTCACGTTGTTACAGTCAATGAATATTTAGCACAACGTGATGCGAGCGAAATGGGACAACTTCATGAGTTCCTTGGCTTAACG...............GTAGGAATTAACTTA...............AATAGTATG...TCACGCGAA............GAGAAA...............CAAGAGGCTTATGCTGCTGATATTACGTATAGCACAAATAATGAGCTTGGATTCGATTACTTACGTGATAACATGGGTTTATATAAAGAGGAGTGCGTTCAACGT.........CCACTTCACTTTGCTATTATCGATGAAGTCGATTCTATTTTAGTCGATGAAGCACGTACGCCGCTTATTATTTCAGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGTGTAGAAATTCAAAATGAAAGCATGACGCTTGCAACAATTACATTC...CAGAACTACTTCCGTATGTATGAAAAATTATCTGGTATGACTGGTACAGCGAAAACAGAGGAAGAGGAATTCCGT
TRN  11011101111011000
NAM  Q8ENI7_OCEIH/1-383
ASQ  maGILTKIFG.DGNQKQLKR.LEKQVDLIEQLEPEMEKLEDIDFKNKTEEFKTRYKNGE........SLNDLLIEVYALVREASKRVLGMRPFRTQLLGAIALHEGNISEMKTGEGKTLASTMPAYLNALTDEGVHIITVNDYLAERDAKDNGLLFDFLGIT.....VGFNH.....NGL.SKD....EK.....REAYLADITYGTNNEFGFDYLRDNMVLYKEQMVQR...PLNFAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLQIQNESMTLASITF.QNYFRMYNKLSGMTGTAKTEEEEFR
DSQ  atggcaGGCATTTTGACCAAAATATTTGGT...GATGGTAACCAAAAACAATTAAAACGA...TTAGAAAAACAAGTAGATTTAATTGAACAGTTAGAACCTGAAATGGAGAAGCTAGAGGATATAGATTTTAAAAATAAAACGGAAGAGTTTAAGACACGTTATAAAAATGGAGAA........................TCTTTGAATGACCTATTAATAGAAGTTTATGCACTAGTTCGAGAAGCTTCTAAACGTGTACTTGGCATGCGTCCTTTCCGTACACAGTTATTGGGTGCGATTGCCTTGCATGAAGGTAATATTTCTGAAATGAAAACAGGGGAAGGTAAAACACTTGCTTCCACGATGCCCGCATACTTGAATGCATTAACAGATGAAGGTGTACACATTATCACTGTTAATGATTACTTAGCAGAACGTGATGCGAAAGATAATGGGTTATTATTTGATTTTCTTGGTATAACA...............GTAGGTTTTAATCAT...............AATGGCCTT...TCAAAAGAT............GAAAAA...............CGTGAAGCTTATCTAGCAGACATTACCTACGGAACAAATAACGAATTTGGCTTTGATTATTTGCGTGATAATATGGTCTTATACAAAGAGCAAATGGTACAGCGA.........CCTTTAAATTTTGCAATTATTGATGAGGTAGACTCTATTCTCATAGACGAAGCTCGTACACCATTAATTATTTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGATTGCAAATTCAAAATGAAAGTATGACGTTAGCATCTATTACTTTC...CAGAACTATTTCCGAATGTATAATAAATTATCAGGAATGACTGGTACTGCCAAAACAGAAGAAGAAGAGTTTAGG
TRN  10010101110011000
NAM  Q9K6W8_BACHD/1-383
ASQ  mlGLLKKVVG.DPSQRQLKK.NQKIADQVEALSDEMKSLSDDGLRQKTEEFKKRYKNGE........SLDDLLPEAYAVVREAATRVLNMTPYPVQILGAIALHQGNIAEMKTGEGKTLVGTMPVYLNALAGKGVHVVTVNDYLARRDSEQMGAMFEFLGLT.....VGLNV.....PGL.SKE....EK.....KEAYQADITYGTNNEFGFDYLRDNMVLYKEQMVQR...SLNFALVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLQIQRESMTLASITF.QNYFRMYQKLAGMTGTAKTEEEEFR
DSQ  atgttaGGGTTACTAAAAAAGGTTGTTGGC...GATCCAAGTCAGCGCCAGTTGAAAAAA...AATCAAAAAATCGCCGACCAAGTAGAAGCGTTAAGTGACGAAATGAAGTCACTTTCCGATGATGGGTTGCGTCAAAAAACAGAGGAATTTAAAAAGAGGTATAAGAACGGGGAA........................TCTCTCGATGACTTGCTTCCAGAAGCATACGCTGTTGTAAGAGAGGCAGCAACACGTGTGTTAAATATGACTCCATATCCTGTTCAAATTCTTGGAGCGATCGCCCTTCACCAAGGAAATATCGCTGAGATGAAAACTGGGGAAGGTAAGACGCTCGTTGGGACGATGCCTGTTTATTTAAATGCCCTTGCCGGTAAAGGTGTTCATGTAGTGACGGTCAACGATTATTTGGCACGTCGTGATAGCGAACAAATGGGCGCGATGTTCGAGTTTCTCGGATTAACG...............GTAGGTTTGAACGTG...............CCAGGGCTC...TCCAAGGAA............GAAAAA...............AAGGAGGCTTATCAGGCCGATATTACGTATGGAACAAACAATGAATTTGGGTTCGATTACTTGCGGGATAACATGGTGCTCTATAAGGAGCAAATGGTGCAGCGG.........TCCCTAAATTTCGCTCTTGTTGATGAGGTCGATTCCATTCTTATTGACGAAGCGCGTACGCCGCTCATCATCTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAAGGTTTGCAAATTCAGCGTGAGAGCATGACCCTTGCTTCAATTACATTC...CAAAACTATTTCCGGATGTATCAAAAGCTTGCAGGGATGACTGGTACGGCAAAAACAGAAGAAGAGGAATTCCGT
TRN  10010101110011000
NAM  SECA_LISMO/5-382
ASQ  lkKIFESGK-.----KDVKY.LERKADEIIALADETAALSDDALREKTVEFKERVQKGE........TLDDLLVEAFAVAREGAKRALGLYPFKVQLMGGIVLHEGNIAEMKTGEGKTLTATLPVYLNALSGEGVHVVTVNEYLAHRDAEEMGVLYNFLGLS.....VGLNL.....NAL.SST....EK.....REAYACDITYSTNNELGFDYLRDNMVVYKEEMVQR...PLAFAVIDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVTIQNESKTMATITF.QNYFRMYKKLAGMTGTAKTEEEEFR
DSQ  ttgaaaAAAATTTTTGAATCAGGAAAA---...------------AAAGATGTTAAATAT...TTGGAGAGAAAAGCAGATGAGATTATTGCTTTAGCGGATGAAACTGCGGCTCTTTCGGATGATGCTCTACGTGAAAAAACAGTAGAGTTTAAAGAGCGTGTTCAAAAAGGTGAG........................ACGCTGGATGACTTATTGGTAGAAGCATTTGCTGTTGCCAGAGAAGGTGCGAAACGTGCGCTAGGATTGTATCCATTTAAAGTTCAATTAATGGGTGGAATTGTTCTCCACGAAGGTAACATTGCAGAGATGAAAACTGGTGAAGGTAAAACGTTAACAGCGACACTACCAGTTTATTTAAATGCACTTTCTGGTGAAGGGGTGCATGTGGTTACTGTCAATGAATACTTAGCTCATCGTGATGCCGAAGAAATGGGAGTTTTATACAATTTCCTTGGACTTTCT...............GTAGGGCTTAACCTA...............AATGCTTTA...TCGAGTACA............GAAAAA...............CGAGAAGCTTATGCATGTGATATTACGTATAGCACAAATAATGAATTAGGATTTGACTATTTGCGTGATAACATGGTCGTTTACAAAGAAGAAATGGTACAACGT.........CCGCTAGCTTTTGCTGTTATCGATGAAGTCGATTCCATTTTGGTCGATGAAGCGAGAACACCATTAATTATTTCTGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGCGTAACTATTCAAAACGAATCCAAAACAATGGCGACAATTACATTC...CAAAACTATTTCCGTATGTATAAAAAACTTGCAGGGATGACGGGTACTGCAAAAACGGAAGAAGAAGAGTTCCGC
TRN  10010101100011000
NAM  SECA_STAAU/4-388
ASQ  lsKILDGNN-.----KEIKQ.LGKLADKVIALEEKTAILTDEEIRNKTKQFQTELADIDnvk.kqndYLDKILPEAYALVREGSKRVFNMTPYKVQIMGGIAIHKGDIAEMRTGEGKTLTATMPTYLNALAGRGVHVITVNEYLSSVQSEEMAELYNFLGLT.....VGLNL.....NSK.TTE....EK.....REAYAQDITYSTNNELGFDYLRDNMVNYSEDRVMR...PLHFAIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVQIQNESKTMASITF.QNYFRMYNKLAGMTGTAKTEEEEFR
DSQ  ttatcaAAAATTCTTGATGGCAATAAT---...------------AAAGAAATTAAACAG...TTAGGTAAACTTGCTGATAAAGTAATCGCTTTAGAAGAAAAAACGGCAATTTTAACTGATGAAGAAATTCGTAATAAAACGAAACAATTCCAAACAGAATTAGCTGACATTGATaatgtcaaa...aagcaaaatgatTATTTAGATAAAATTTTACCAGAAGCATATGCACTTGTTAGAGAAGGCTCTAAACGTGTATTCAATATGACACCATATAAAGTTCAAATTATGGGTGGTATTGCAATTCATAAAGGTGATATCGCTGAGATGAGAACAGGTGAAGGTAAAACATTAACAGCGACAATGCCAACATACTTAAATGCATTAGCTGGTAGAGGTGTTCACGTTATTACAGTCAATGAATACTTATCAAGTGTTCAAAGTGAAGAAATGGCTGAGTTATATAACTTCTTAGGTTTGACT...............GTCGGATTAAACTTA...............AACAGTAAG...ACGACAGAG............GAAAAA...............CGTGAAGCATACGCACAAGACATTACTTACAGTACTAATAATGAGCTAGGTTTTGATTACTTACGAGATAACATGGTGAATTATTCTGAAGATAGGGTAATGCGT.........CCATTACATTTTGCAATCATTGATGAGGTGGACTCAATTTTAATCGACGAGGCACGTACGCCATTAATTATTTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCGAAGGAAGGCGTTCAAATTCAAAATGAATCTAAAACTATGGCGTCTATTACATTC...CAAAACTATTTCAGAATGTACAATAAACTTGCGGGTATGACAGGTACAGCTAAAACTGAAGAAGAAGAATTTAGA
TRN  10010101110011000
NAM  Q9PNZ1_CAMJE/6-396
ASQ  lkAVFGTKND.----REVKK.YFKRVAQINALEGNYQNLSDDELKAEFAKFKEQILSGE.......kNENDVLNDVFAIVRETGKRTLNMRHFDVQLIGGMVLHDGKIAEMKTGEGKTLVATLPVVLNAMSGKGVHVVTVNDYLAKRDAEQMSAIYNFLGFS.....VGVVL.....SSQnSDI....EH.....KQAYDCDITYGTNNEFGFDYLRDNMKFSKAEKVQR...EHNFVIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVKIQEESQTLADITF.QNYFRMYNKLAGMTGTAQTEATEFS
DSQ  ttaaaaGCCGTGTTTGGCACAAAAAATGAT...------------CGTGAAGTTAAGAAA...TATTTCAAGCGTGTAGCACAAATCAATGCTTTAGAAGGCAACTATCAAAATTTAAGCGATGATGAATTAAAAGCTGAATTTGCAAAATTTAAAGAGCAAATTTTAAGCGGAGAA.....................aaaAACGAAAATGATGTTTTAAATGATGTTTTTGCTATAGTCAGAGAGACAGGTAAGAGAACTTTAAATATGCGTCATTTTGATGTGCAGTTAATCGGTGGTATGGTTTTGCACGATGGAAAAATCGCAGAAATGAAAACAGGAGAAGGTAAAACTCTTGTAGCGACCTTACCTGTTGTTTTAAATGCCATGAGTGGCAAAGGCGTACATGTCGTTACAGTAAATGATTATCTAGCCAAAAGAGATGCTGAGCAAATGAGTGCGATTTATAATTTTTTAGGTTTTAGT...............GTTGGCGTGGTGCTT...............TCTTCTCAAaatAGTGATATA............GAACAC...............AAGCAAGCTTATGATTGTGATATTACTTATGGAACCAATAATGAGTTTGGTTTTGATTATTTGCGTGATAATATGAAATTTTCAAAAGCTGAAAAAGTTCAAAGA.........GAGCATAATTTTGTTATCGTAGATGAAGTAGATAGTATTTTAATTGATGAGGCAAGAACTCCGCTTATCATCAGTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAAAATGTAAAAATTCAAGAAGAAAGCCAAACTCTAGCAGATATTACTTTT...CAAAATTATTTTAGAATGTACAATAAACTTGCAGGTATGACAGGAACTGCACAAACAGAAGCGACTGAATTTTCT
TRN  10010101110011000
NAM  SECA_HELPY/6-391
ASQ  igKIIGTRND.----RWIKQ.YKKQVLTINALEPTYEKMSDDELQNAFEELKKRVRSTEkd..lqekTLLEVLPESFAITREASKRILKMCHFDVQLIGGMVLNDGKIAEMKTGEGKTLVATLAVALNALKGESVYVVTVNDYLAHRDSKEMEPLYHFLGYS.....VGTIT.....ASVrDDD....ER.....LEIYSKDIVYGTNNEFGFDYLRDNMKYSLEHKVQK...SHAFAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVSIKEESQTLADITF.QNYFRMFSKLAGMTGTAQTEATEFL
DSQ  attggaAAAATCATTGGCACCAGAAACGAT...------------CGCTGGATCAAACAA...TACAAAAAACAAGTCCTAACTATCAACGCCTTAGAGCCTACTTATGAAAAAATGAGCGACGATGAGCTGCAAAACGCTTTTGAAGAGTTAAAAAAACGAGTGCGATCCACAGAAaaagat......ttgcaagaaaaaACCCTTTTAGAAGTCCTGCCTGAAAGTTTTGCAATCACTAGAGAAGCGAGCAAAAGGATCTTAAAGATGTGCCATTTTGACGTGCAACTCATTGGGGGCATGGTCTTAAACGATGGCAAAATCGCTGAAATGAAAACTGGAGAGGGTAAAACTTTAGTCGCTACTTTAGCGGTGGCTTTGAACGCTTTAAAGGGCGAGAGCGTGTATGTGGTAACCGTTAATGATTATCTAGCCCATAGGGATTCTAAAGAAATGGAGCCGTTGTATCATTTCTTAGGTTATAGC...............GTAGGCACGATCACT...............GCAAGCGTGcgaGATGATGAT............GAGCGC...............TTGGAAATTTATTCTAAAGACATTGTTTATGGCACTAATAATGAATTTGGTTTTGATTATCTAAGGGATAACATGAAATATTCTTTAGAGCATAAGGTGCAAAAA.........TCGCATGCGTTCGCTATTGTTGATGAGGTGGATTCCATTTTAATTGATGAAGCGAGAACCCCTTTAATCATTTCAGGG...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAGGGCGTGAGCATTAAAGAAGAGAGCCAAACCTTAGCCGATATCACTTTC...CAAAATTATTTCAGGATGTTTTCTAAACTCGCTGGCATGACAGGCACGGCTCAAACCGAAGCCACAGAATTTTTA
TRN  10010101100011000
NAM  Q83N29_TROWT/6-385
ASQ  leRILRAGEG.----RTLKR.LRNIAHTVNAIEDEYKGCTDGELRTFAFDLKVRHQNGE........SLDSILPEAFAMVREASSRTLGLRHFDVQIMGGAALHMGYIAEMFTGEGKTLVATLPAFLNSLSGNGVHIVTVNDYLAGYHSQQMGRVYKVLGLE.....TGVIL.....ADQ.DPS....TR.....AQQYRADITYGTNNEFGFDYLRDNMAWSCAERVQR...GHNFVILDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEIKAENQTLATVTL.QNYFRLYKKISGMTGTAVTEASEFM
DSQ  ctcgagAGGATCCTGCGCGCCGGCGAGGGT...------------CGCACCCTCAAGAGA...TTGCGTAATATAGCCCACACCGTCAATGCCATCGAGGACGAATATAAAGGCTGTACAGACGGTGAACTGCGCACTTTTGCTTTTGATCTCAAAGTTCGTCATCAGAATGGCGAG........................TCCCTTGACAGCATTCTTCCGGAAGCATTCGCAATGGTTAGAGAAGCCTCGTCTCGAACGCTGGGTCTTAGGCATTTTGATGTTCAGATTATGGGTGGTGCCGCGTTACACATGGGGTATATTGCAGAAATGTTCACAGGTGAAGGTAAAACTTTGGTTGCAACGCTCCCGGCTTTTCTCAATTCCCTCTCGGGTAACGGCGTCCATATAGTTACGGTGAACGATTACCTTGCTGGATATCACTCACAGCAAATGGGCAGGGTATACAAGGTATTGGGACTCGAG...............ACCGGGGTTATTTTG...............GCTGATCAG...GATCCCTCA............ACGCGT...............GCTCAACAATACAGGGCGGATATCACTTATGGAACTAATAACGAGTTTGGGTTTGATTATCTTCGGGATAACATGGCCTGGAGTTGCGCCGAGAGAGTTCAAAGG.........GGTCATAATTTTGTGATCCTCGACGAGGTAGATTCAATTTTGATTGATGAGGCAAGGACTCCTCTAATTATCTCCGGG...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAGGGCGTTGAAATCAAGGCGGAAAATCAAACACTTGCAACGGTTACTTTG...CAAAATTATTTTCGTCTCTATAAAAAAATCTCCGGCATGACGGGCACCGCAGTAACAGAGGCCTCTGAATTCATG
TRN  10010101100011000
NAM  Q8G4G5_BIFLO/5-384
ASQ  idKALRMGEG.----HQLKK.LENVAKAVNALEDEISALSDEDLKAQTPKFKQEIENGK........SLDEIMPEAFATVREVSKRTLGQRHFDVQLMGGAALHWGNIAEMKTGEGKTLVATLPTYLNALEGRGVHVVTVNDYLASYQSELMGRIYRFLGMN.....VGCII.....TEQ.KPP....ER.....RKQYNADITYGTNNEFGFDYLRDNMAWEKADLVQR...GHHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEVKAENQTFATITL.QNYFRMYDKLAGMTGTAETEAAEFM
DSQ  attgacAAAGCCCTGCGAATGGGTGAAGGC...------------CACCAGCTCAAGAAG...CTGGAGAACGTGGCCAAGGCCGTGAACGCTCTTGAGGACGAGATCTCCGCCCTCTCTGACGAGGATCTGAAGGCCCAAACCCCGAAGTTCAAGCAGGAAATCGAAAACGGCAAG........................AGCCTGGACGAGATCATGCCCGAGGCGTTCGCCACCGTGCGCGAGGTCTCCAAGCGCACCCTTGGCCAGCGTCACTTCGACGTGCAGCTCATGGGCGGTGCTGCCCTGCACTGGGGCAACATCGCCGAAATGAAGACCGGTGAAGGCAAGACCCTGGTCGCCACCCTGCCCACCTATCTGAACGCTCTCGAAGGCAGGGGCGTGCACGTGGTCACCGTCAACGACTACCTCGCCAGCTACCAGAGCGAGCTGATGGGCCGTATCTACCGTTTCCTCGGCATGAAC...............GTCGGCTGCATCATC...............ACCGAGCAG...AAGCCGCCG............GAGCGC...............CGCAAGCAGTACAACGCTGACATCACCTACGGCACCAACAACGAGTTCGGCTTCGACTACCTGCGTGACAACATGGCATGGGAGAAGGCCGACCTCGTGCAGCGC.........GGTCACCACTACGCCATCGTCGATGAGGTCGATTCCATCCTCATCGATGAGGCCCGTACCCCGCTTATCATCTCCGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAAGGCGTGGAGGTCAAGGCCGAGAACCAGACCTTCGCCACCATCACCCTG...CAGAACTACTTCCGTATGTACGACAAGCTCGCGGGCATGACCGGTACGGCCGAAACCGAGGCCGCCGAGTTCATG
TRN  10010101100011011
NAM  SECA_STRGR/4-395
ASQ  fnKLMRAGEG.----KILRK.LHRIADQVSSIEEDFVNLSDAELRALTDEYKERYADGE........SLDDLLPEAFATVREAAKRVLGQRHYDVQMMGGVALHLGYVAEMKTGEGKTLVGTLPAYLNALSGKGVHLITVNDYLAERDSELMGRVHKFLGLS.....VGCIV.....ANM.TPA....QR.....REQYGCDITYGTNNEFGFDYLRDNMAWSKDELVQR...GHNFAVVDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVDIKDENQTLATITLqQNFFRLYDKLSGMTGTAMTEAAEFH
DSQ  ttcaacAAGCTCATGCGTGCAGGCGAAGGC...------------AAGATCCTGCGCAAA...CTGCACCGCATCGCGGACCAGGTCAGCTCCATCGAAGAGGACTTCGTCAACCTCTCCGACGCCGAGCTGCGGGCGCTCACCGACGAGTACAAGGAACGGTACGCGGACGGCGAG........................AGCCTGGACGACCTGCTTCCCGAAGCGTTCGCCACGGTCCGTGAGGCCGCGAAGCGCGTCCTCGGACAGCGCCACTACGACGTACAGATGATGGGCGGAGTCGCCCTGCACCTCGGCTATGTGGCCGAGATGAAGACCGGTGAGGGCAAGACCCTCGTCGGTACCCTGCCCGCGTATCTGAACGCGCTCTCCGGCAAGGGCGTGCACCTGATCACGGTCAACGACTATCTCGCCGAGCGCGACTCCGAGCTGATGGGCCGGGTCCACAAGTTCCTCGGCCTGAGC...............GTCGGCTGCATCGTC...............GCCAACATG...ACGCCGGCC............CAGCGC...............CGCGAGCAGTACGGCTGCGACATCACGTACGGCACGAACAACGAGTTCGGCTTCGACTACCTCCGCGACAACATGGCGTGGTCCAAGGACGAGCTCGTCCAGCGC.........GGCCACAACTTCGCCGTGGTCGACGAGGTCGACTCGATCCTCGTCGACGAGGCCCGTACGCCGCTGATCATCTCCGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCGAAGGAAGGGGTGGACATCAAGGACGAGAACCAGACCCTCGCCACGATCACCCTGcagCAGAACTTCTTCCGCCTCTACGACAAGCTCTCCGGCATGACCGGTACGGCGATGACCGAGGCCGCCGAGTTCCAC
TRN  11011101101011011
NAM  SECA1_MYCTU/2-383
ASQ  lsKLLRLGEG.----RMVKR.LKKVADYVGTLSDDVEKLTDAELRAKTDEFKRRLADQKn.....peTLDDLLPEAFAVAREAAWRVLDQRPFDVQVMGAAALHLGNVAEMKTGEGKTLTCVLPAYLNALAGNGVHIVTVNDYLAKRDSEWMGRVHRFLGLQ.....VGVIL.....ATM.TPD....ER.....RVAYNADITYGTNNEFGFDYLRDNMAHSLDDLVQR...GHHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVEIKAENQTLATITL.QNYFRLYDKLAGMTGTAQTEAAELH
DSQ  ctgtcgAAGTTGCTGCGCCTTGGCGAAGGT...------------CGCATGGTCAAGCGC...CTCAAGAAGGTGGCCGACTATGTCGGCACTTTGTCCGACGATGTCGAGAAACTCACCGACGCCGAGCTGAGGGCGAAAACCGACGAGTTCAAGCGGCGGCTGGCCGACCAGAAAaac...............ccagaaACCCTCGACGACCTGTTGCCCGAGGCCTTCGCCGTGGCCCGCGAGGCCGCCTGGCGGGTGCTGGACCAGCGGCCGTTCGACGTGCAGGTGATGGGTGCGGCCGCCCTGCACCTGGGCAACGTTGCCGAGATGAAGACCGGTGAAGGCAAGACCCTGACCTGTGTGTTGCCCGCTTACCTCAATGCGCTGGCCGGCAACGGCGTGCACATCGTCACCGTCAACGACTACCTGGCTAAACGCGACAGTGAGTGGATGGGCCGCGTGCACCGCTTCCTCGGGCTTCAG...............GTCGGGGTGATTTTG...............GCCACCATG...ACACCCGAT............GAACGC...............CGGGTGGCCTATAACGCCGACATCACCTACGGCACCAATAACGAGTTTGGGTTCGACTACCTGCGCGACAACATGGCGCACTCACTGGATGATCTGGTGCAGCGC.........GGGCACCATTACGCCATTGTCGACGAGGTCGATTCCATCCTGATCGACGAGGCCCGCACCCCGCTGATCATCTCCGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAGCACGTCGAGATCAAGGCCGAGAACCAGACGCTGGCCACCATCACGCTG...CAGAACTACTTCCGGCTCTACGACAAGCTCGCCGGCATGACCGGCACCGCCCAGACGGAGGCGGCCGAGCTGCAC
TRN  10010101100011001
NAM  Q8FRI7_COREF/4-382
ASQ  lsKMLRVGEG.----RAVKR.LQKIADQVIALEDQYANLTDEELKAKTEEFKDRLAQGE........TLDDIFLDAFATAREASWRVLGQKHYKVQIMGGAALHFGNVAEMRTGEGKTLTCVLPAYLNALEGKGVHVVTVNDYLAKRDAEWMGRVHRWLGLS.....VGVIL.....SEL.RPA....ER.....KVAYDCDITYGTNNELGFDYLRDNMARSLNDLVQR...GHHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEKVEIKNENQTLATVTL.QNYFRLYEKLSGMTGTAETEAAELH
DSQ  ttgtccAAGATGCTCCGCGTCGGCGAAGGC...------------CGTGCCGTGAAGCGA...CTCCAGAAGATCGCTGACCAGGTCATCGCACTGGAAGACCAGTATGCCAACCTCACTGATGAGGAGCTCAAGGCCAAGACTGAGGAATTTAAGGACCGACTCGCCCAGGGGGAG........................ACCCTCGACGATATCTTCCTCGATGCCTTCGCCACCGCCCGTGAGGCCTCCTGGCGTGTGCTGGGACAGAAGCACTACAAGGTGCAGATCATGGGTGGCGCGGCCCTGCATTTCGGAAACGTCGCTGAGATGCGCACCGGTGAGGGCAAGACCCTGACCTGTGTGCTGCCCGCCTACCTCAATGCGCTCGAGGGCAAGGGTGTCCACGTGGTCACGGTCAATGACTACCTGGCCAAGCGTGACGCCGAGTGGATGGGCCGTGTGCACCGCTGGCTGGGCCTGTCC...............GTCGGTGTCATCCTC...............TCCGAGCTC...CGCCCCGCC............GAGCGC...............AAGGTCGCCTATGACTGCGACATCACCTACGGCACCAACAATGAGCTGGGCTTTGACTACCTGCGCGACAACATGGCCCGTTCCCTCAACGACCTGGTGCAGCGT.........GGACACCACTACGCCATCGTCGATGAGGTTGACTCCATCCTCATCGATGAGGCCCGCACCCCGCTGATCATCTCCGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAGAAGGTGGAGATCAAAAACGAGAACCAGACTCTGGCCACCGTCACCCTC...CAGAACTACTTCCGCCTCTACGAGAAGCTGTCCGGCATGACCGGTACCGCCGAGACCGAGGCCGCCGAGCTGCAC
TRN  11011101101011011
NAM  SECA_SPIOL/85-467
ASQ  lgNLLFNFKGgDPAESTKQQ.YASTVTLINQLEPQISSLTDSQLTDRTSLLRQRALSGE........SLDSILPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMRTGEGKTLVAILPAYLNALTGKGVHVVTVNDYLARRDCEWVGQVARFLGLK.....VGLVQ.....QNM.TSE....VR.....RENYLCDITYVTNSELGFDFLRDNLATSVDELVLR...GFNFCVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVPIQNETITLASISY.QNFFLQFPKLCGMTGTAATESAEFE
DSQ  ttgggaAACTTGTTGTTTAACTTTAAGGGTggcGACCCTGCTGAATCCACCAAGCAGCAG...TATGCCTCCACCGTCACTCTCATTAATCAGTTGGAACCTCAAATTTCTAGTTTAACCGATTCTCAACTCACTGACCGCACTTCTCTCCTTCGCCAACGCGCTCTTTCCGGCGAA........................TCTCTTGATTCTATTCTCCCCGAAGCTTTTGCTGTTGTCAGGGAGGCTTCCAAGAGGGTTTTAGGCCTTCGCCCGTTTGATGTCCAACTCATTGGAGGCATGGTGCTACACAAAGGAGAAATAGCGGAAATGCGAACCGGAGAAGGCAAAACATTAGTTGCCATATTACCAGCGTATCTCAATGCCTTGACTGGTAAAGGGGTTCATGTTGTCACTGTTAATGATTATTTAGCCCGCCGTGATTGTGAGTGGGTTGGCCAAGTTGCTCGATTTCTTGGTCTCAAG...............GTTGGCCTTGTTCAG...............CAGAACATG...ACAAGTGAA............GTAAGG...............AGGGAAAATTATTTATGTGACATCACATACGTCACTAATAGTGAGCTTGGATTTGATTTTTTGAGAGACAATCTTGCCACGAGTGTTGATGAGCTCGTATTGAGG.........GGTTTCAATTTCTGCGTAATTGATGAGGTTGATTCTATACTTATTGATGAAGCAAGAACTCCTTTGATCATATCTGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAGGAAGGCGTGCCTATACAAAATGAAACAATAACATTGGCTTCTATTAGCTAT...CAGAACTTTTTTCTTCAGTTCCCCAAACTCTGTGGGATGACCGGCACAGCAGCTACTGAGAGTGCAGAATTTGAG
TRN  10010101110011010
NAM  SECA_GUITH/1-379
ASQ  mlNVLFG---.DPNERRINP.YKQIVNKINYLEAKLKKLTDSELQEQTERFIKLLSNNS........SNEELLPEIYATVREASLRVLGLRHFDVQLIGGLILNDGKIAEMKTGEGKTLVALLPTYLNALAGFGVHVVTVNDYLARRDSEWVGQVHKFLGLT.....VGLIQ.....EGM.SQF....ER.....RENYLKDVTYATNSELGFDYLRDNMAIDLEDIVQR...PFYFCVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKESVPIQSETQTLASITY.QNFFLLYPKLSGMTGTAKTEETELD
DSQ  atgttaAATGTATTATTCGGT---------...GATCCAAATGAGCGAAGAATAAATCCG...TATAAGCAAATTGTTAATAAAATTAATTATTTAGAAGCAAAGCTTAAAAAATTGACTGATAGTGAATTGCAAGAACAGACAGAACGGTTTATTAAACTGTTGTCTAACAATTCA........................TCTAATGAAGAATTATTGCCAGAAATTTATGCGACTGTACGTGAAGCTTCACTTAGAGTTTTAGGTTTGAGACATTTTGATGTTCAGTTAATCGGCGGACTAATTTTAAATGATGGTAAAATTGCAGAGATGAAAACTGGTGAAGGTAAAACTTTAGTAGCTTTATTACCAACGTATTTGAATGCTCTAGCTGGTTTTGGTGTTCATGTTGTAACTGTGAATGATTATTTAGCTCGACGTGATTCTGAGTGGGTTGGCCAGGTACATAAATTTTTAGGTTTAACT...............GTGGGTTTAATACAG...............GAGGGAATG...TCACAATTT............GAACGT...............CGCGAAAATTATTTAAAAGACGTTACATATGCTACTAATAGTGAGTTGGGATTTGATTACTTACGCGATAATATGGCTATCGATTTGGAGGATATTGTTCAACGA.........CCATTTTATTTTTGTGTGATTGATGAAGTTGACTCCATTTTAATTGATGAAGCAAGAACTCCTTTAATTATATCAGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAAGAATCTGTACCTATCCAATCAGAGACACAAACTCTAGCTTCTATAACGTAT...CAAAATTTCTTCTTATTGTATCCCAAATTATCAGGAATGACAGGGACAGCAAAAACAGAAGAAACCGAATTAGAT
TRN  10010101100011000
NAM  SECA_PORPU/1-379
ASQ  mfNLLFSSS-.--NQRRINS.YAATVKKINSLEQKIGNLSDEELFTKTSYFKDELKKGV........TLDYILPEAFSVVREAGCRVLGLRVFDVQIIGAIILHQGKIAEMKTGEGKTLVATLAGYLNALSGKGVHIVTVNDYLARRDSEWVGQIHKFLGLS.....VGLIQ.....QDL.SKA....ER.....KLAYQCDVTYVTNSELGFDYLKDNMVLSMSEIVQN...KFAFCIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEQVPIQQENQTYASITY.QNFFLLYPKLSGMTGTAKTEESELD
DSQ  atgttcAATCTTTTATTTAGTAGCTCT---...------AACCAAAGAAGAATAAATAGT...TATGCAGCAACTGTAAAAAAGATAAATTCTTTGGAGCAAAAAATAGGAAATCTTTCAGACGAAGAATTATTTACTAAAACTAGTTATTTCAAGGATGAATTAAAAAAAGGGGTT........................ACACTAGATTATATTTTGCCTGAAGCTTTTTCTGTAGTTCGAGAAGCTGGTTGTAGAGTTTTAGGTCTAAGAGTATTTGATGTTCAAATAATAGGTGCTATTATTTTACATCAAGGTAAAATAGCTGAAATGAAAACAGGAGAAGGGAAAACCTTGGTAGCAACCTTAGCAGGCTATCTCAACGCTTTATCTGGAAAGGGTGTTCATATTGTTACAGTTAATGATTATCTTGCAAGGAGAGACTCAGAGTGGGTTGGTCAAATTCATAAATTTTTAGGTTTATCA...............GTTGGTTTAATTCAA...............CAAGATCTA...TCAAAAGCA............GAAAGA...............AAACTAGCATATCAATGCGATGTGACTTATGTAACTAATAGTGAACTAGGTTTTGATTATCTAAAAGATAATATGGTTTTATCTATGTCGGAAATAGTTCAAAAT.........AAGTTTGCTTTCTGCATTATTGATGAAGTGGATTCTATACTAATTGATGAGGCTAGGACTCCACTAATCATTTCAGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAGCAGGTTCCTATTCAACAAGAAAATCAAACCTATGCATCAATAACATAT...CAGAATTTTTTCTTACTATATCCGAAGCTATCAGGAATGACTGGGACAGCTAAAACAGAAGAGTCCGAGCTAGAT
TRN  10010101110011000
NAM  SECA_SYNP7/1-397
ASQ  mlNLLLG---.DPNVRKVKK.YKPLVTEINLLEEDIEPLSDKDLIAKTAEFRQKLDKVShspaaekeLLAELLPEAFAVMREASKRVLGLRHFDVQMIGGMILHDGQIAEMKTGEGKTLVATLPSYLNALSGKGAHVVTVNDYLARRDAEWMGQVHRFLGLS.....VGLIQ.....QGM.SPE....ER.....RRNYNCDITYATNSELGFDYLRDNMAAVIEEVVQR...PFNYAVIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXSKEGVEIQPETQTLASITY.QNFFLLYPKLSGMTGTAKTEELEFE
DSQ  atgctgAATTTGCTGCTGGGC---------...GATCCCAACGTCCGCAAAGTCAAAAAG...TACAAACCCCTCGTCACTGAAATCAATCTGTTGGAAGAGGACATTGAGCCACTGTCCGACAAGGATTTAATTGCCAAAACGGCTGAGTTTCGCCAGAAGCTCGACAAGGTTTCCcactcgccagctgcagagaaggaaTTGCTGGCGGAGTTGCTGCCCGAAGCCTTTGCGGTCATGCGCGAAGCCAGTAAACGAGTGCTGGGGCTGCGCCACTTTGATGTGCAGATGATCGGCGGCATGATTCTGCACGACGGTCAGATTGCCGAGATGAAGACGGGTGAAGGGAAAACCCTCGTCGCTACGCTGCCGTCCTATCTCAATGCACTGTCGGGTAAAGGTGCGCACGTCGTCACCGTCAACGACTACTTGGCTCGCCGCGACGCGGAATGGATGGGACAAGTCCACCGCTTCCTAGGCTTGAGT...............GTTGGCCTAATCCAG...............CAGGGAATG...TCGCCGGAA............GAGCGT...............CGCCGCAACTACAACTGCGACATTACCTACGCTACCAACAGCGAACTGGGCTTTGATTACCTGCGCGACAACATGGCCGCAGTGATTGAAGAGGTAGTCCAGCGT.........CCCTTCAACTACGCCGTGATCGACGAGGTGGACTCGATTCTGATCGACGAAGCCCGGACACCCTTGATCATTTCCGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTCGAAGGAAGGCGTTGAGATTCAACCCGAAACCCAAACCCTTGCTTCGATTACTTAC...CAAAACTTCTTCCTGCTCTACCCCAAACTGTCGGGCATGACCGGTACGGCGAAGACAGAAGAGTTGGAGTTTGAG
TRN  11011101101011010
NAM  Q8YMS8_ANASP/1-379
ASQ  mlKLLLG---.DPNARKLKK.YQPYITEINLLEEDIKVLSDEDLKGKTAEFKQRLAKGE........TLDDILPEAFAVVREAGRRVLGLRHFDVQMLGGVILHSGQIAEMKTGEGKTLVATLPSYLNALTGKGVHVITVNDYLARRDAEWMGQVHRFLGLS.....VGLIQ.....SSM.TPS....ER.....QKNYECDITYVTNSEVGFDYLRDNMATSMADVVQR...PFNYCVIDEVDSILVDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVDIQPETQTLATITY.QNLFLLYPKLGGMTGTAKTEEAEFE
DSQ  atgctaAAACTCTTGTTGGGC---------...GACCCCAACGCTCGTAAACTCAAAAAA...TACCAACCCTATATTACAGAAATTAATCTCTTGGAAGAGGACATTAAAGTCCTCTCTGATGAAGATTTAAAAGGTAAAACAGCAGAGTTTAAACAGCGACTTGCCAAAGGCGAA........................ACTTTGGATGATATCTTGCCAGAAGCCTTTGCTGTGGTAAGAGAGGCAGGACGGCGAGTCTTAGGGTTGCGGCATTTTGATGTCCAGATGTTAGGCGGTGTCATTCTGCATAGTGGACAAATCGCCGAAATGAAAACCGGTGAAGGTAAAACCTTGGTGGCTACCTTACCGAGTTATTTAAATGCTTTGACTGGTAAGGGTGTACACGTAATCACCGTGAACGATTACCTGGCTCGTCGGGACGCAGAATGGATGGGACAGGTGCATCGCTTTCTGGGTTTGAGT...............GTCGGGCTGATTCAA...............TCCAGTATG...ACACCTAGT............GAACGC...............CAGAAAAACTATGAGTGCGATATCACTTACGTGACCAATAGTGAAGTTGGTTTCGACTATCTGCGGGATAACATGGCTACATCGATGGCTGATGTGGTACAGCGT.........CCCTTTAACTATTGCGTCATTGACGAAGTAGATTCGATTTTAGTGGATGAGGCACGGACACCTCTCATTATTTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAAGAACACGTAGATATACAACCAGAAACTCAAACTTTAGCGACAATTACCTAT...CAAAACCTCTTCTTGTTGTATCCCAAATTAGGTGGGATGACAGGAACAGCGAAGACAGAAGAAGCTGAGTTTGAA
TRN  10010101100011010
NAM  SECA_SYNY3/1-386
ASQ  mlKALFG---.DPNTRKLKK.FQPYVAEVNLYEEDIEKLSDDELKYKTVEFREALDKARsda.eteeILDEILPEAFAVVREAGKRVLGMRHFDVQLLGGIILHKGQIAEMKTGEGKTLVATLPSYLNGLTGKGVHVVTVNDYLARRDAEWMGQIHRFLGLT.....VGLVQ.....SGM.NPE....ER.....KKNYACDITYTTNSELGFDYLRDNMSTAMIEVVQR...PFNFCIIDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKERVEIQKESQTLATITY.QNFFLLYPKLSGMTGTAKTEETELE
DSQ  atgttaAAAGCCCTCTTTGGT---------...GATCCCAATACCCGCAAACTGAAAAAG...TTTCAACCCTACGTGGCGGAGGTCAACCTCTACGAAGAGGACATTGAAAAGCTGTCTGACGATGAGTTGAAGTATAAAACCGTCGAATTTCGGGAAGCGTTGGATAAGGCCCGCagcgatgcg...gaaacagaagaaATCCTAGACGAAATTTTGCCAGAAGCCTTTGCCGTGGTGCGGGAAGCGGGGAAACGGGTGTTGGGTATGCGTCACTTTGACGTGCAACTGTTGGGGGGCATTATTCTCCACAAAGGGCAAATTGCGGAAATGAAAACTGGGGAAGGAAAAACCCTGGTGGCCACTCTACCTTCCTATCTGAACGGTTTAACGGGCAAAGGGGTCCATGTGGTGACGGTGAACGATTACCTGGCCCGGCGGGATGCGGAATGGATGGGGCAAATCCATCGCTTTTTGGGCTTAACG...............GTGGGTCTAGTACAG...............TCCGGCATG...AATCCTGAG............GAAAGG...............AAAAAGAATTACGCCTGCGATATTACCTACACCACCAACAGCGAACTAGGGTTTGACTATTTACGGGACAACATGTCCACCGCCATGATTGAAGTGGTACAGCGC.........CCCTTTAATTTTTGCATCATTGACGAAGTTGACTCGATTTTAATTGATGAAGCCCGTACTCCTTTGATCATTTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAGGAGCGGGTGGAAATCCAAAAGGAAAGTCAAACTTTGGCCACTATTACTTAC...CAAAATTTCTTTCTGCTTTACCCCAAACTTTCCGGCATGACGGGGACAGCCAAAACGGAAGAAACGGAATTGGAA
TRN  10010101100011010
NAM  SECA_ANTSP/1-375
ASQ  mfNFLFS---.----NKINQ.YQRIVKQINSLDSTYNKYSDQELKQQTNKLKDQIIATQ........DIDTILPKAFAITKEAIKRATGLLLFDVQLIGAIILNQGKIAEMKTGEGKTLVAMLTAYLNSLFNKGVHIVTVNEYLAKRDATLAKQIFEYLNIH.....IGIID.....QSM.HSQ....ER.....KKQYSCDITYLTNSELGFDYLRDNMAIQKEDLVQR...DFFFAIIDEIDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEKQKIQQENKTLASITY.QNLFLLYEKLSGMTGTAKTEEAELE
DSQ  atgtttAATTTTCTATTTTCT---------...------------AACAAGATCAATCAA...TATCAAAGAATAGTAAAACAAATTAATAGTTTAGATTCAACATACAATAAATACTCAGATCAAGAATTAAAACAACAAACTAATAAATTAAAAGATCAAATTATAGCAACTCAA........................GATATAGATACAATTCTTCCTAAAGCATTTGCAATAACAAAAGAAGCTATTAAAAGAGCTACTGGATTATTACTCTTTGATGTACAGCTAATTGGAGCAATCATTCTAAATCAGGGAAAAATAGCTGAAATGAAAACAGGTGAAGGCAAAACATTAGTAGCAATGTTAACAGCATACTTAAATTCATTATTTAATAAAGGAGTACATATTGTTACTGTTAATGAATATCTAGCTAAAAGAGATGCAACATTAGCAAAACAAATTTTTGAATATTTAAATATTCAT...............ATTGGCATAATAGAT...............CAATCAATG...CACTCACAA............GAGCGA...............AAAAAACAATATTCATGTGATATTACATATCTAACAAACAGTGAATTAGGATTTGATTACCTTAGAGATAACATGGCCATACAAAAAGAAGATCTTGTACAAAGA.........GACTTTTTTTTTGCAATTATAGATGAAATAGATTCAATCCTAATCGATGAAGCAAGAACACCACTTATTATTTCAGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAAAACAAAAAATTCAACAGGAAAATAAAACTTTAGCCTCAATTACATAT...CAAAATCTATTTTTATTATATGAAAAATTATCAGGAATGACAGGTACAGCAAAAACAGAAGAAGCTGAACTAGAA
TRN  10010101110011000
NAM  SECA_ODOSI/1-377
ASQ  mlKNPFKKK-.----SIADK.YQTLIREINALESTVKTLTDGELRNKTNQLKQRYQDEQ........NLNNLIVESFALTREASYRTLGLRHFDVQLIGGLVLNGGKIAEMRTGEGKTLVATLPAYLNALTKKGVHIVTVNEYLASRDQTSMGQIYRFLGLE.....TGLIQ.....EKM.TTP....ER.....QRNYKADITYVTNNELGFDYLRDNLALNIRDVFLR...PFNYCIVDEVDSVLIDEALTPLIIAN.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENVAIRQTTEITASITY.QNFFLVYPKLSGMTGTAKTAEVEFD
DSQ  atgttaAAAAATCCATTTAAAAAAAAA---...------------TCAATTGCAGATAAG...TACCAAACTCTAATTCGTGAAATTAATGCACTCGAGAGTACGGTCAAAACTTTAACTGATGGCGAATTAAGAAATAAAACAAATCAATTAAAACAACGATACCAGGATGAACAA........................AACTTAAATAATTTAATTGTAGAATCTTTTGCGTTAACAAGAGAAGCCAGTTATCGTACTTTAGGATTACGACACTTTGATGTTCAATTAATTGGTGGTTTAGTTTTAAATGGCGGTAAAATAGCAGAAATGCGAACAGGAGAAGGTAAAACTTTAGTAGCGACTTTGCCAGCATACTTAAATGCATTAACAAAAAAAGGTGTTCATATTGTCACGGTAAATGAATATTTAGCTAGTCGTGATCAAACTTCTATGGGTCAAATTTATCGATTTTTAGGATTAGAA...............ACTGGCTTAATTCAA...............GAAAAAATG...ACAACTCCT............GAACGT...............CAACGAAACTATAAAGCCGATATTACCTATGTCACTAATAATGAATTAGGATTTGATTATTTAAGGGATAATTTAGCTTTAAATATTCGTGATGTGTTCTTACGA.........CCATTTAATTATTGTATCGTTGATGAAGTTGATTCAGTTTTAATTGATGAAGCATTAACACCATTAATTATTGCTAAT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAAATGTAGCGATTCGCCAAACTACTGAGATAACTGCTTCAATTACTTAT...CAAAATTTCTTCTTAGTTTACCCGAAATTATCAGGTATGACCGGAACGGCAAAAACTGCAGAAGTAGAATTTGAC
TRN  10010101110011000
NAM  SECA_PAVLU/1-377
ASQ  mlKDILRKT-.--TQSDLYR.YENIVKKINDLERVMKPLTNEELRAKTLGFRKSIEDGQ........SIDNILPEAFGLVREASLRILGLRHYDVQLIGGCILHDSKIAEMKTGEGKTLVAILPAYLNALSGKSVHIVTVNEYLAKRDSLSVGRVLSFLGLS.....VGLIL.....ADM.NRE....ER.....QENYKCDVIYTTNSELGFDYLRDNLVGNPSEKVQN...GFEFAIIDEVDSVLIDEARTPLIISR.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVTVGSETMTMASITY.QNFFLFYKKLSGMTGTALTEAKEFK
DSQ  atgttaAAGGACATACTTAGAAAAACA---...------ACACAAAGTGATTTATACCGG...TACGAGAATATCGTTAAAAAAATAAACGATCTCGAAAGGGTTATGAAACCTTTGACCAATGAAGAACTTAGAGCTAAAACATTGGGTTTTAGAAAATCAATAGAGGACGGGCAA........................AGCATTGACAATATACTTCCAGAAGCCTTTGGATTAGTACGGGAAGCGTCTTTAAGAATTCTAGGGCTTAGACATTATGATGTGCAATTGATTGGTGGTTGTATACTCCACGATAGTAAAATCGCCGAGATGAAGACAGGCGAGGGAAAAACACTGGTTGCAATACTACCTGCATATTTAAATGCGCTAAGTGGAAAAAGTGTACACATAGTTACAGTGAATGAGTATTTAGCTAAACGTGATAGTTTATCGGTAGGCAGAGTACTTAGTTTTCTTGGTCTTAGT...............GTTGGCTTGATCTTA...............GCTGATATG...AATAGAGAA............GAGAGG...............CAAGAAAACTACAAATGTGACGTTATATATACAACAAATAGTGAGCTAGGTTTTGATTATTTGAGGGATAACCTAGTTGGAAATCCTTCTGAGAAAGTTCAAAAT.........GGTTTTGAATTTGCGATAATTGATGAGGTTGATTCTGTTTTAATTGACGAAGCGCGAACACCACTAATAATCTCCCGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAGGAAGGCGTGACGGTTGGTAGCGAAACCATGACTATGGCCTCGATCACTTAC...CAGAATTTCTTTTTGTTTTACAAAAAGTTATCCGGTATGACTGGTACAGCATTAACAGAAGCGAAGGAATTCAAA
TRN  10010101100011000
NAM  SECA_CYACA/8-386
ASQ  afNMVNTYID.---YLRLRK.YWKILNQIKKHREEIKQLTNNCLKIKTTEFKKRIKSGI........SLDQILPETFAVASEAAERVLGLNPYDVQMIGGIVLHEGKIAEMKTGEGKSLAASFPAYLNALTEKGVHIITVNDYLARRDYESIGKIFEFLGMK.....VGLIN.....QYT.PIS....KR.....KNNYLADITYVTNSEIGFDYLRDNMATQIKELTQR...PFHFCIIDEVDSILIDESRTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKENLQIKEETKTLASITY.QNLFLLYLKISGMTGTAKTEENELI
DSQ  gcatttAACATGGTGAATACTTATATCGAT...---------TACTTGAGACTACGAAAA...TATTGGAAAATATTAAATCAAATAAAAAAACATCGAGAAGAAATTAAGCAATTAACAAATAACTGTCTAAAAATAAAAACTACTGAATTTAAAAAACGAATAAAATCTGGAATT........................TCTTTAGATCAGATATTGCCCGAAACATTTGCGGTCGCAAGTGAGGCTGCTGAACGAGTATTAGGACTTAATCCCTATGATGTTCAAATGATTGGAGGGATAGTATTACATGAAGGAAAAATCGCAGAAATGAAAACTGGAGAAGGAAAAAGTTTGGCAGCCTCGTTTCCTGCGTATCTAAATGCTTTAACAGAAAAAGGGGTTCATATTATTACTGTCAATGATTATTTAGCTAGAAGAGACTATGAATCAATTGGCAAAATTTTTGAGTTCCTAGGGATGAAA...............GTGGGCTTAATAAAC...............CAATACACT...CCAATAAGC............AAAAGG...............AAAAACAATTATCTCGCAGATATTACATATGTGACTAACAGCGAAATTGGATTTGATTATTTGCGAGACAATATGGCCACACAAATTAAAGAACTAACTCAAAGA.........CCTTTCCATTTTTGCATTATTGACGAGGTCGATTCCATTTTAATTGATGAATCAAGGACCCCTTTAATTATCTCAGGG...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAAAACCTACAGATAAAAGAAGAGACTAAAACGCTTGCATCAATAACATAC...CAAAACTTGTTTTTGCTTTATTTAAAGATATCTGGAATGACCGGCACTGCCAAAACTGAAGAAAATGAATTAATA
TRN  10010101110011000
NAM  Q9XI14_ARATH/68-451
ASQ  lkRNVQDFT-.SMNYWVVRD.YYRLVESVNSLEPQIQSLSDEQLKAKTAEFRERLARGE........SLADMQAEAFAVVREAAKRTIGMRHFDVQIIGGGVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVNDYLAQRDAEWMGRVHRFLGLS.....VGLIQ.....RGM.KAE....ER.....KFNYSCDITYTNNSELGFDYLRDNLTSNREQLVMRwpkPFHFAIVDEVDSVLIDEGRNPLLISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLEIQADSIVVAQITY.QSLFKLYPKLSGMTGTAKTEEKEFL
DSQ  ttgaagAGGAATGTACAAGATTTTACG---...AGCATGAATTATTGGGTTGTCCGGGAC...TACTACCGTCTGGTGGAATCTGTCAATTCCCTTGAACCACAGATTCAAAGCCTTTCCGATGAACAGCTGAAAGCTAAAACTGCTGAATTTCGAGAAAGATTAGCACGAGGGGAG........................TCCCTAGCAGATATGCAAGCTGAGGCATTTGCTGTTGTCCGTGAAGCTGCAAAGAGAACAATTGGAATGCGTCATTTTGACGTGCAGATAATTGGTGGAGGAGTGCTTCATGATGGATCCATTGCGGAGATGAAGACAGGTGAAGGGAAAACACTAGTTTCTACCTTAGCTGCATATCTTAATGCATTAACTGGTGAGGGCGTTCATGTGGTTACTGTGAATGATTACCTGGCACAGCGTGATGCTGAATGGATGGGTCGTGTTCACCGCTTCTTAGGCCTTTCA...............GTTGGTCTCATTCAG...............AGAGGGATG...AAAGCTGAA............GAGAGA...............AAATTCAACTATAGCTGTGATATAACATACACCAATAACTCGGAGCTTGGATTTGATTATCTACGAGATAACCTTACTTCAAACCGTGAACAACTTGTTATGAGAtggccaaaaCCATTTCACTTTGCAATAGTTGATGAAGTGGACTCAGTCCTCATTGATGAAGGCAGAAATCCTTTGCTAATTAGTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAAGGTCTAGAAATTCAGGCTGATTCAATTGTTGTGGCTCAAATCACCTAT...CAGTCGCTCTTTAAACTCTATCCAAAGCTCTCCGGGATGACTGGGACAGCAAAAACAGAAGAAAAAGAATTTTTG
TRN  10010101100011000
NAM  Q9RWU0_DEIRA/10-407
ASQ  mfRVLNKVF-.DNNKRDVERiIQTVVKPVNALEEETMRV--ENLAEAFMDLRRRVQDGG.......eSLDSLIVPAFALIREAGRRSIGKRHYDTQLIGGAALHQGRIAEMRTGEGKTLVATLALAFNALEGKGCHLVTVNDYLARVGMEEMGLLYRTLGLT.....VGLAN.....REL.SPA....EK.....QAAYACDITYVTNSELGFDYLRDNMAQSKEALVLRadtPLHYAIVDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVKIENENQTLATITY.QNFFRLYDKFAGMTGTAKTEEKEFL
DSQ  atgtttCGTGTCCTGAACAAAGTGTTC---...GACAATAACAAACGCGATGTCGAACGCatcATCCAAACGGTGGTGAAACCGGTCAATGCGCTTGAAGAAGAGACGATGCGCGTT------GAGAACCTCGCCGAAGCCTTTATGGACCTGCGCCGCCGCGTGCAGGACGGGGGC.....................gagTCCCTCGACAGCTTGATCGTGCCCGCTTTTGCCCTGATCCGCGAGGCGGGGCGCCGCTCCATCGGCAAACGCCACTACGACACCCAGCTCATCGGCGGGGCCGCGCTGCACCAGGGCCGCATCGCCGAAATGCGCACCGGCGAAGGCAAAACGCTGGTGGCGACGCTGGCGCTCGCCTTCAACGCGCTGGAAGGCAAAGGCTGCCACCTCGTCACGGTCAACGACTACCTCGCCCGCGTGGGCATGGAAGAAATGGGCCTGCTCTACCGCACGCTCGGGCTGACG...............GTGGGGCTCGCCAAC...............CGCGAACTC...TCGCCCGCC............GAAAAG...............CAGGCCGCTTACGCCTGCGACATCACCTACGTCACCAACTCCGAACTCGGCTTCGATTACCTGCGCGACAACATGGCGCAGTCGAAAGAAGCGCTGGTGCTGCGCgccgacacgCCGCTGCACTACGCCATCGTGGACGAGGTGGACTCGATCCTGATCGACGAGGCCCGCACCCCGCTGATCATCTCGGGG...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAAGAAGGCGTCAAGATCGAGAACGAGAACCAGACGCTCGCCACCATCACCTAC...CAGAACTTCTTCCGCCTGTACGACAAGTTCGCCGGGATGACCGGCACCGCCAAGACCGAGGAAAAGGAATTCCTC
TRN  11011101101011011
NAM  Q81UI7_BACAN/5-383
ASQ  vkKLLGDSQK.----RKLKK.YEQLVQEINNLEEKLSDLSDEELRHKTITFKDMLRDGK........TVDDIKVEAFAVVREAAKRVLGLRHYDVQLIGGLVLLEGNIAEMPTGEGKTLVSSLPTYVRALEGKGVHVITVNDYLAKRDKELIGQVHEFLGLK.....VGLNI.....PQI.DPS....EK.....KLAYEADITYGIGTEFGFDYLRDNMAASKNEQVQR...PYHFAIIDEIDSVLIDEAKTPLIIAG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLEITEENQTQASITI.QNFFRMYPALSGMTGTAKTEEKEFN
DSQ  gtaaaaAAGCTGTTAGGAGATTCTCAAAAG...------------AGAAAACTTAAAAAA...TATGAACAACTTGTTCAAGAAATTAATAATTTAGAAGAAAAACTATCTGATTTATCTGATGAAGAATTACGTCATAAAACGATCACATTTAAAGACATGCTTCGTGACGGAAAA........................ACGGTGGATGATATAAAAGTTGAAGCGTTCGCTGTTGTACGTGAAGCAGCAAAACGTGTACTTGGATTACGTCACTACGATGTGCAGTTAATTGGTGGCCTTGTACTATTAGAAGGTAATATTGCAGAGATGCCAACTGGCGAAGGAAAAACATTAGTTTCTTCTCTTCCAACGTACGTACGTGCTCTTGAAGGAAAAGGTGTTCACGTTATTACTGTAAACGACTATTTAGCAAAACGAGATAAAGAATTGATTGGCCAAGTTCATGAATTTCTAGGTTTAAAG...............GTTGGATTGAATATT...............CCTCAAATT...GATCCTTCC............GAAAAG...............AAACTTGCTTACGAAGCTGATATTACATATGGTATTGGAACAGAATTTGGCTTTGACTATTTACGTGATAATATGGCCGCTTCAAAAAATGAACAGGTACAACGC.........CCCTATCATTTTGCTATTATCGATGAGATTGATAGCGTTTTAATTGATGAAGCAAAGACGCCTCTTATTATCGCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAAGGCTTAGAAATCACAGAAGAAAACCAAACACAAGCGTCCATTACAATT...CAAAACTTCTTCCGTATGTATCCAGCATTATCTGGTATGACAGGTACAGCAAAAACGGAAGAAAAAGAATTTAAC
TRN  10010101100011000
NAM  Q98RA6_MYCPU/5-381
ASQ  lkEIPFFKS-.----TEMKI.AEKTLQQINDLEPSVVNLTDEELQNKTDEFVRRIQEGE........TLEHIRPEVFAVSREATKRVLKKRPYDVQMLGGIILDLGSVAEMRTGEGKTITSIAPVYLNALEKKGVIVSTVNEYLAERDAAEMGEVFSFLKMT.....VGVNK.....PSM.SPE....EK.....KQIYQCDITYSIHSELGFDYLRDNMVTNINDKVQR...GLNYILLDEVDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEFLEIESETKTLATITY.QNFFRMFKKLSGMTGTAKTEEQEFI
DSQ  ctaaaaGAAATACCATTTTTTAAATCA---...------------ACTGAAATGAAAATT...GCTGAAAAAACTCTCCAACAAATTAATGACCTTGAGCCTTCTGTAGTAAATTTAACTGATGAAGAGCTTCAAAACAAAACTGATGAATTTGTAAGAAGAATTCAAGAGGGAGAA........................ACTCTTGAACACATTCGTCCTGAAGTTTTTGCAGTTTCTCGAGAGGCTACAAAAAGGGTTTTGAAAAAGCGTCCTTATGATGTTCAAATGCTTGGTGGAATTATTTTGGATTTAGGTTCAGTTGCAGAGATGAGAACTGGAGAGGGAAAAACCATTACTTCAATAGCTCCAGTTTATTTAAATGCTTTGGAAAAAAAGGGAGTAATTGTCTCTACTGTTAATGAGTATTTAGCAGAGCGTGATGCAGCGGAGATGGGTGAGGTTTTTAGTTTTTTGAAAATGACA...............GTAGGTGTTAATAAA...............CCTTCAATG...AGCCCTGAG............GAAAAA...............AAACAAATTTATCAGTGTGATATCACCTATTCAATTCACTCGGAGCTAGGTTTTGACTATCTTAGAGATAATATGGTTACAAACATTAATGATAAAGTTCAAAGA.........GGTCTAAATTACATTTTGCTTGATGAGGTTGATTCAATTTTAATTGATGAGGCTAGAACTCCTTTAATTATCTCTGGA...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAGTTTTTAGAAATTGAAAGTGAAACTAAAACACTTGCAACAATTACTTAC...CAAAACTTTTTTAGGATGTTCAAAAAACTCTCAGGTATGACCGGAACTGCCAAAACTGAAGAGCAAGAATTTATT
TRN  10010101110011000
NAM  SECA_BORBU/6-406
ASQ  leTTIGSKSK.----RDLKD.YLPTLRNINKLERWALLLADEDFSKETEKLKDELKSGN........SLENILERAFTLSREAARRRLKERPYDVQIIAGLALHKGKIIEMKTGEGKTLSSVQAAYLNSLTGDGVIIVTVNDYLAERDSNWMKPVFDLLGVS.....VGVVL.....SNM.DYE....LR.....KAQYAKDITYVTNNELGFDYLRDNMRYDLNEKSLR...KFNYCIIDEIDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVRVANENKTMATITF.QNLFRMFDKISGMTGTADTEAKEFH
DSQ  cttgagACAACTATTGGCTCAAAAAGTAAA...------------AGAGATTTAAAAGAT...TATCTTCCGACTTTAAGAAATATTAATAAGCTTGAGCGTTGGGCATTATTGTTGGCAGATGAAGATTTTTCAAAGGAGACAGAAAAGCTTAAAGATGAATTAAAATCGGGTAAT........................TCTTTAGAGAATATTTTAGAGCGAGCTTTTACTCTGTCTAGAGAAGCTGCTAGAAGGCGTCTTAAAGAAAGGCCTTATGATGTGCAAATCATTGCGGGGCTTGCTCTTCACAAAGGCAAAATAATAGAAATGAAAACGGGAGAAGGAAAAACTCTCTCCTCAGTTCAAGCGGCGTATTTAAATAGTTTAACAGGAGATGGGGTTATTATTGTTACTGTTAATGACTATCTTGCAGAACGTGATTCCAATTGGATGAAGCCGGTTTTTGATCTTTTGGGTGTTAGC...............GTGGGGGTTGTTCTA...............TCTAATATG...GATTATGAG............CTAAGA...............AAGGCTCAATATGCTAAAGATATTACTTATGTTACAAATAATGAACTTGGATTTGATTATCTAAGAGATAATATGCGTTATGACTTGAATGAAAAATCCTTGAGA.........AAGTTTAATTATTGTATTATTGATGAAATTGATTCTATTTTGATCGATGAGGCAAGAACTCCATTGATTATTTCAGGG...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTAAAGAAGGAGTTAGAGTTGCTAATGAAAATAAGACTATGGCAACTATTACTTTT...CAAAATTTATTTAGAATGTTTGATAAAATTTCTGGCATGACAGGTACAGCTGATACAGAAGCTAAGGAATTTCAT
TRN  10010101100011000
NAM  SECA_TREPA/6-409
ASQ  alRLIFGSQ-.--HERDLKN.LLPLLNAVNAQESWVLPLQESEFKQKTAEFKARAAAGE........ALDAFLPQAFALAREAARRVLGERPYDVQILGSLVLHHGKIVEMKTGEGKTLMSVAAAYLNSLSGRGVHIVTVNDYLAERDARWMRPVYDYLGVS.....VGVIL.....SSM.GSQ....ER.....RCAYACDITYGTNNELGFDYLRDNMQFLTEEKTQR...DFYFAIIDEIDSILIDEARTPLIISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHIRIAQRNRTMATITF.QNFFRMYKKLSGMTGTADTEALELN
DSQ  gcactcAGGCTCATCTTTGGCTCCCAG---...------CACGAGCGCGATCTGAAAAAT...CTCCTGCCTCTTTTGAATGCCGTCAACGCCCAGGAGTCCTGGGTACTTCCTCTCCAGGAGTCTGAGTTCAAACAAAAAACAGCTGAGTTTAAGGCGCGTGCCGCTGCAGGAGAA........................GCGCTTGACGCTTTTTTACCTCAGGCATTTGCGCTTGCGCGCGAGGCAGCTCGTCGTGTTTTAGGCGAGCGTCCCTATGACGTGCAGATCCTCGGTTCCCTCGTCCTCCACCACGGCAAAATCGTGGAAATGAAAACGGGCGAAGGCAAAACGCTCATGAGCGTGGCAGCGGCGTATCTGAACAGTCTTTCGGGGAGGGGTGTGCATATTGTCACGGTCAACGACTATCTTGCTGAGCGCGACGCGCGATGGATGCGTCCAGTATATGATTATTTAGGCGTTTCC...............GTCGGCGTCATCCTC...............TCTTCCATG...GGCAGTCAG............GAGCGG...............CGGTGTGCGTACGCGTGCGATATTACCTACGGTACCAACAATGAACTGGGCTTTGATTATCTGCGCGACAACATGCAATTTTTAACGGAAGAAAAAACGCAGCGT.........GATTTTTACTTTGCCATTATTGACGAGATTGACTCCATTCTCATCGACGAGGCGCGCACACCGCTTATTATCTCAGGG...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAACACATCCGCATTGCGCAACGTAATCGCACTATGGCAACTATCACGTTT...CAGAACTTTTTTAGAATGTATAAAAAGCTTTCTGGAATGACGGGAACTGCGGATACCGAGGCGTTGGAGCTCAAT
TRN  10010101100011000
NAM  SECA_OLILU/1-379
ASQ  mfNFLENEK-.----YKLKE.YQPLVNQINLLETSVKNYTDIELKEQFDKLRKEYFLSQ.......nFSNDIIARSFSLTREAAFRTIGLRPFDQQLLGGLVLNSGKITEMKTGEGKTLVATLPAALNAISGRGVHIVTVNDYLAKRDSTWMGQIYDYLGLT.....VGLVQ.....SQM.ESQ....ER.....KDNYFQDITYITNSELGFDYLRDNQVKTFQEMVQR...KFNYCIIDEVDAILIDEARTPLVLSIpXXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKESIDITQTSRISSSITY.QNFFTLYPKLAGMTGTAKSAALELE
DSQ  atgtttAATTTTTTAGAAAATGAAAAA---...------------TACAAATTAAAAGAA...TACCAACCATTGGTTAATCAAATTAATTTGTTAGAAACATCTGTTAAAAATTATACAGATATTGAATTAAAGGAACAATTCGATAAATTAAGAAAGGAATATTTTTTAAGTCAA.....................aacTTTTCAAATGATATTATTGCCAGATCTTTCTCTTTAACTCGGGAAGCAGCATTTCGAACTATTGGGTTGAGACCGTTTGATCAACAATTATTAGGTGGCTTAGTATTAAATAGTGGTAAAATTACGGAAATGAAAACTGGTGAGGGAAAAACATTGGTAGCAACTTTACCAGCAGCATTAAATGCAATTAGTGGAAGGGGGGTTCATATTGTAACCGTAAATGATTATTTAGCAAAACGCGACTCTACTTGGATGGGTCAAATTTATGATTACTTGGGATTAACT...............GTTGGTTTAGTTCAA...............TCCCAAATG...GAATCACAA............GAAAGA...............AAAGATAATTATTTTCAAGATATTACATATATTACTAATAGTGAATTAGGGTTTGATTATCTTAGAGATAATCAAGTTAAAACCTTTCAAGAAATGGTTCAACGA.........AAATTTAATTATTGTATAATTGATGAAGTTGATGCTATTTTAATTGATGAGGCCCGAACTCCTTTAGTTCTTTCAATTcccXXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAATCAATTGATATTACACAAACAAGTAGAATTTCTTCCTCAATTACTTAT...CAAAACTTTTTTACTCTTTATCCAAAATTAGCTGGAATGACTGGTACGGCAAAATCCGCAGCCCTGGAATTAGAA
TRN  10010101100011000
NAM  Q97P83_STRPN/1-382
ASQ  mfRRLGQDF-.-----QLRK.VKKILKQINALKGKMSSLSDQELVAKTVEFRQRLSEGE........SLDDILVEAFAVVREADKRILGMFPYDVQVMGAIVMHYGNVAEMNTGEGKTLTATMPVYLNAFSGEGVMVVTPNEYLSKRDAEEMGQVYRFLGLT.....IGVPFtedpkKEM.KAE....EK.....KLIYASDIIYTTNSNLGFDYLNDNLASNEEGKFLR...PFNYVIIDEIDDILLDSAQTPLIIAG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEHVKLSPETRAMASITY.QSLFKMFNKISGMTGTGKVAEKEFI
DSQ  gtgtttAGACGTTTAGGTCAAGATTTC---...---------------CAGCTTAGGAAA...GTGAAAAAGATTTTAAAGCAGATTAATGCCCTGAAAGGCAAGATGTCCTCTCTTTCGGATCAAGAATTAGTAGCTAAAACAGTAGAGTTTCGTCAGCGTCTTTCCGAGGGAGAA........................AGTCTAGACGATATTTTGGTTGAAGCTTTTGCTGTGGTGCGTGAAGCAGATAAGCGGATTTTAGGGATGTTTCCTTATGATGTTCAAGTCATGGGAGCTATTGTCATGCACTATGGAAATGTTGCTGAGATGAATACGGGGGAAGGTAAGACCTTGACAGCTACCATGCCTGTCTATTTGAACGCTTTTTCAGGAGAAGGAGTGATGGTTGTGACTCCTAATGAGTATTTATCAAAGCGTGATGCCGAGGAAATGGGTCAAGTTTATCGTTTTCTAGGATTGACC...............ATTGGTGTACCATTTacggaagatccaaagAAGGAGATG...AAAGCTGAA............GAAAAG...............AAGCTTATCTATGCTTCGGATATCATCTACACAACCAATAGTAATTTAGGTTTTGATTATCTAAATGATAACCTAGCCTCGAATGAAGAAGGTAAGTTTTTACGA.........CCGTTTAACTATGTGATTATTGATGAAATTGATGATATCTTGCTTGATAGTGCACAAACTCCTCTGATTATTGCGGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAACATGTCAAATTATCTCCTGAGACGCGGGCTATGGCCTCGATCACCTAT...CAGAGTCTTTTTAAGATGTTTAATAAGATATCTGGTATGACAGGGACAGGTAAGGTCGCGGAAAAAGAGTTTATT
TRN  10010101100011000
NAM  Q8DYM7_STRA5/3-386
ASQ  afNSLFSLDK.----KRLKK.LQRTLNTINSLKGQMATLSNEELQAKTTEFRKRLVNGE........TLDDICAEAFAVVREADERVLGLFPYDVQVIGGLVLHQGNTAEMKTGEGKTLTATMPLYLNALEGKGAMLLTNNSYLAIRDAEEMGKVYRFLGLS.....VGVGV.....SDN.EEE....DRdaatkRAVYSSDIVYSTSSALGFDYLIDNLASSKSQKYMP...KLHYAIVDEADAVLLDMAQTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXQKEHLNVTPESRAMASITY.QNLFRMFTKLAGMTGTGKTAEKEFI
DSQ  gcctttAATAGTTTATTTTCGTTAGATAAG...------------AAACGTTTAAAAAAA...CTTCAGCGTACTTTAAATACTATCAATAGTTTAAAGGGCCAAATGGCAACACTATCAAATGAGGAGTTGCAAGCTAAGACAACTGAATTTAGAAAACGTTTAGTTAATGGGGAA........................ACACTAGATGATATTTGTGCTGAAGCTTTTGCTGTTGTTAGGGAAGCTGATGAGCGCGTATTAGGTCTATTTCCGTATGATGTACAGGTAATCGGTGGTCTTGTTCTGCACCAAGGAAATACTGCTGAGATGAAAACTGGTGAAGGAAAAACATTAACTGCCACTATGCCTTTGTATCTCAATGCTTTAGAAGGGAAGGGGGCAATGTTGCTGACTAATAATTCCTACCTTGCTATTCGAGATGCGGAAGAAATGGGAAAAGTATATCGTTTTTTAGGATTGAGT...............GTCGGTGTGGGAGTT...............TCTGATAAT...GAGGAAGAG............GATAGAgatgctgcgactaagCGAGCTGTTTATAGTTCGGATATTGTCTATAGTACAAGTAGTGCACTAGGCTTTGATTATTTAATTGATAACCTAGCTTCATCTAAATCTCAAAAATATATGCCC.........AAGTTACATTATGCTATTGTAGATGAAGCTGATGCAGTTCTTCTAGATATGGCCCAGACTCCTTTAGTTATTTCAGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCAAAAAGAGCATCTTAATGTCACACCAGAGTCTCGAGCAATGGCTTCCATTACCTAT...CAAAATCTTTTTAGAATGTTTACTAAATTGGCTGGAATGACAGGAACTGGAAAAACTGCTGAAAAAGAGTTTATT
TRN  10010101100011000
NAM  Q8NUJ8_STAAW/1-386
ASQ  mkHKLDVTI-.--NELRLKS.IRKIVKRINTWGDEVKSYSDDALKQKTIEFKERLASGV.......dTLDTLLPEAYAVAREASWRVLGMYPKEVQLIGAIVLHEGNIAEMQTGEGKTLTATMPLYLNALSGKGTYLITTNDYLAKRDFEEMQPLYEWLGLTaslgfVDIVD.....YEY.QKG....EK.....RNLYEHDIIYTTNGRLGFDYLIDNLADSAEGKFLP...QLNYGIIDEVDSIILDAAQTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGMEVSTDKSVMATITF.QNLFKLFESFSGMTATGKLGESEFF
DSQ  atgaaaCATAAACTAGATGTTACGATA---...------AACGAATTAAGACTAAAGTCG...ATTAGAAAAATAGTGAAACGCATCAATACATGGGGCGATGAAGTTAAATCATATTCTGATGATGCGTTAAAACAAAAGACAATAGAATTTAAAGAACGTTTAGCATCAGGAGTT.....................gatACACTAGATACATTGTTACCTGAAGCTTATGCAGTGGCACGTGAAGCGAGCTGGAGAGTATTAGGTATGTATCCTAAAGAAGTTCAGTTAATCGGAGCGATTGTATTGCATGAAGGTAACATTGCGGAGATGCAAACAGGCGAAGGTAAAACATTAACAGCAACGATGCCTTTATATTTAAATGCACTTTCGGGAAAAGGAACATATTTAATTACAACGAATGATTATTTAGCGAAGCGTGATTTTGAAGAGATGCAACCATTATATGAATGGTTAGGTTTAACTgcttcattaggttttGTTGATATTGTGGAT...............TATGAGTAT...CAAAAAGGG............GAAAAA...............CGTAATTTATATGAACATGATATTATATATACAACTAATGGACGTCTCGGTTTTGATTATTTAATTGATAATTTGGCTGATAGTGCGGAAGGGAAATTTTTACCA.........CAATTAAATTACGGTATTATTGATGAAGTGGACTCAATCATTTTAGATGCTGCGCAAACACCATTAGTTATTTCGGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCGAAAGAAGGTATGGAGGTTTCAACAGATAAAAGTGTTATGGCAACAATTACCTTC...CAGAATTTATTTAAACTTTTTGAATCATTTTCAGGTATGACAGCTACAGGAAAATTAGGCGAATCAGAGTTCTTT
TRN  10010101110011000
NAM  Q8CMU9_STAEP/1-386
ASQ  maKGVNQII-.--NNIRLRK.LRKILNQINALSEEFSNFSDEALQAKTKEFKVYLNDNK.......aSLNHILPQAYATVREASKRVLGMYPKDVQILGAIAMHQGNIAEMQTGEGKTLTATMPLYLNALTGKGAYLITTNDYLAKRDFLEMKPLYEWLGLS.....VSLGF.....VDIpEYEyaenEK.....YELYHHDIVYTTNGRLGFDYLIDNLADDIRAKFLP...KLNFAIIDEVDSIILDAAQTPLVISG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXALENVEISQDMSVMATITF.QNLFKQFDEFSGMTGTGKLGEKEFF
DSQ  atggctAAAGGTGTTAACCAAATTATT---...------AATAATATTAGGTTAAGAAAA...TTGCGCAAAATATTAAATCAAATTAATGCGCTTAGTGAGGAGTTCTCAAATTTTAGTGATGAAGCACTTCAAGCGAAGACAAAAGAATTTAAAGTTTATTTAAATGATAATAAA.....................gctTCACTCAATCACATTCTGCCACAAGCTTATGCAACAGTTAGAGAGGCTTCTAAGCGCGTTTTAGGTATGTATCCAAAAGATGTGCAGATTTTAGGAGCAATCGCTATGCATCAGGGGAATATTGCAGAAATGCAAACAGGAGAAGGTAAGACGCTTACAGCTACCATGCCTCTGTACTTAAATGCACTTACAGGTAAAGGTGCTTATCTAATCACAACAAATGATTACTTAGCAAAACGCGATTTTTTAGAAATGAAACCACTATATGAATGGCTAGGCTTGTCT...............GTATCATTAGGATTT...............GTGGACATTccaGAATATGAAtacgctgaaaatGAAAAA...............TATGAACTGTACCACCATGACATTGTTTACACGACTAATGGGCGACTAGGGTTTGATTATTTAATTGATAATTTAGCTGATGATATTCGTGCCAAATTTTTACCG.........AAATTAAACTTTGCTATTATTGATGAAGTCGATTCTATTATATTAGACGCTGCCCAAACGCCTTTAGTTATTTCTGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCTCTGGAAAATGTTGAAATTTCTCAAGATATGAGTGTGATGGCAACCATAACATTC...CAAAACTTATTTAAGCAATTTGATGAATTTTCAGGTATGACTGGAACAGGTAAATTAGGGGAAAAAGAATTCTTT
TRN  10010101100011000
NAM  Q83YC1_LISMO/1-376
ASQ  mrQNYDDR--.----KIVKQ.YREIARQIVKKEGLYKNMDQAELCEQTNFWREK-FKTKpm..tdrdKIN-----IFALAREAASRIIGLDAVVVQLIGALVLGDGKVAEMKTGEGKTLMSLFVMFIEVMRGNRVHLVTANEYLARRDREEIGQVLEYLGVS.....VALNE.....SGL.DIA....QK.....KAIYTADVIYGTASEFGFDYLRDNMVRQKEDKVQS...GLDFVLIDEADSILIDEARTPLLISD.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGVEVKEESRTLATITI.QNYFRMYKKISGMTGTAKTEEEEFR
DSQ  atgagaCAGAATTATGATGATCGA------...------------AAAATAGTGAAACAG...TATCGAGAAATAGCCCGCCAAATTGTTAAAAAAGAGGGCTTATATAAAAATATGGATCAGGCTGAACTTTGTGAACAAACCAATTTTTGGCGCGAGAAG---TTCAAGACAAAAccgatg......actgatcgagatAAAATTAAT---------------ATTTTTGCTTTGGCGAGAGAAGCAGCTAGCCGAATTATTGGTCTGGATGCGGTTGTAGTGCAATTAATTGGAGCGCTCGTTCTCGGCGATGGCAAAGTGGCAGAAATGAAAACCGGCGAAGGTAAAACATTGATGTCGTTATTTGTTATGTTTATAGAAGTAATGCGTGGTAATCGTGTACACCTTGTGACTGCCAATGAGTATTTAGCTAGACGTGATCGGGAAGAAATTGGACAAGTGCTGGAATATCTTGGTGTTTCC...............GTTGCGTTAAATGAA...............TCTGGTTTA...GACATAGCC............CAAAAA...............AAGGCCATTTATACAGCAGATGTTATTTATGGAACGGCTTCTGAATTTGGTTTTGATTACTTACGCGACAATATGGTACGCCAAAAAGAAGATAAAGTACAAAGT.........GGACTTGATTTTGTTTTAATAGATGAAGCAGATTCAATTTTAATAGATGAAGCGAGAACTCCCCTACTTATTTCTGAC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAAAAGAGGGTGTTGAAGTAAAAGAAGAATCACGCACGCTAGCAACAATTACAATT...CAAAATTACTTCCGGATGTATAAGAAAATTTCTGGAATGACAGGAACAGCTAAAACTGAGGAAGAAGAATTCCGT
TRN  10010101100011000
NAM  SECA2_MYCLE/16-391
ASQ  fwRLLGASTD.----KNLNY.SSAEVTAAAAYHKEAADLGDEQLRKACGLL--NLNDLA.......dSRD--VPQFLAIVREASERSTGLRPFDVQLLGALRMLAGDVIEMATGEGKTLAGAIAAAGYALAGRHVHVVTINDYLARRDAEWMGPLLEAIGLT.....VGWIT.....AES.TRE....DR.....KAAYGCDVTYASVNEIGFDVLRDQLVTDVDDLVSP...HPDVALIDEADSVLVDEALVPLVLAG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGIETTETGEVLDTITV.QALINRYATVCGMTGTALAAGEQLR
DSQ  ttttggCGGCTACTCGGCGCCAGCACGGAC...------------AAGAACCTAAACTAC...TCTTCCGCTGAGGTCACTGCTGCGGCGGCTTACCACAAGGAAGCTGCCGATCTGGGCGATGAGCAGTTGCGCAAGGCGTGCGGGTTGCTC------AATCTCAACGATCTCGCC.....................gatTCTCGCGAC------GTCCCCCAATTCCTTGCCATCGTCCGGGAAGCGTCTGAGCGGTCCACGGGTTTGAGGCCTTTTGATGTGCAGTTACTCGGGGCGCTACGCATGCTTGCTGGTGACGTGATCGAGATGGCCACCGGTGAGGGCAAAACTCTCGCCGGCGCGATTGCGGCGGCCGGATACGCCCTTGCCGGCCGGCATGTGCACGTCGTGACGATCAACGATTATTTGGCCCGCCGTGATGCGGAATGGATGGGCCCGCTGCTCGAGGCCATAGGCCTGACG...............GTGGGCTGGATCACC...............GCGGAGTCA...ACACGCGAG............GACCGT...............AAGGCTGCTTACGGCTGCGACGTCACCTACGCCTCGGTCAACGAGATCGGTTTTGATGTGCTGCGCGATCAGTTGGTGACCGACGTCGACGACCTGGTATCGCCC.........CATCCTGATGTGGCCCTTATCGACGAGGCCGACTCCGTGCTGGTCGATGAGGCATTGGTGCCGCTCGTGTTAGCCGGT...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCGAAGGAGGGCATCGAGACCACCGAGACCGGCGAAGTGCTCGATACCATCACAGTG...CAGGCACTGATCAATCGTTACGCCACTGTGTGCGGTATGACCGGCACAGCGCTGGCCGCTGGTGAGCAGTTACGC
TRN  10010101100011000
NAM  Q8FTJ6_COREF/19-392
ASQ  fwKALGGKQG.----RNQKR.SLAIVDQAEAHTRDLEALDDAHLAARARTL---VGDGT........PQD--PAELLAVLGIAAHRTLGMRPFPVQSQAVLRLIEGDVVHMATGEGKTLVGAMAATGLGLQGKTVHSITINDYLAVRDAEWMRPLVEFFGLS.....VGAIS.....ETM.TPE....QR.....REAYRCDVVYGSVSEIGFDVLRDQLITRRADAVQR...RADVAIIDEADSVLVDEALVPLVLAG.XXX.XXXX.X.XXXXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXXXXXXXXXX...........X.XXXXX.....XXXXXXXXXXXXXXXXXXXXX.X...X.X.X..XXXXXXXXXXXXXXXXXXXXXXXXXXAKEGLAVTEGGRILDTITL.QALVGRYPMVCGMTGTAVEATDQLR
DSQ  ttctggAAGGCACTCGGCGGCAAACAGGGT...------------CGCAATCAGAAACGC...AGCCTGGCGATCGTCGACCAGGCCGAGGCGCACACCCGCGACCTGGAGGCGCTTGACGACGCCCACCTCGCCGCCCGTGCCCGGACGTTG---------GTCGGGGATGGCACG........................CCCCAGGAC------CCGGCCGAACTGCTCGCGGTCCTCGGCATCGCCGCGCACCGCACCCTCGGCATGCGCCCCTTCCCGGTGCAGTCCCAGGCCGTACTGCGCCTCATCGAAGGCGATGTCGTGCACATGGCCACCGGCGAGGGCAAGACCCTGGTCGGCGCCATGGCCGCCACCGGCCTGGGCCTGCAGGGCAAAACCGTCCACTCCATCACCATCAACGACTACCTCGCGGTCCGCGACGCCGAATGGATGCGCCCCCTGGTCGAGTTCTTCGGATTGAGC...............GTCGGCGCCATCTCC...............GAGACCATG...ACCCCGGAG............CAGCGC...............CGTGAGGCCTACCGCTGCGATGTGGTCTACGGCTCCGTCAGTGAGATCGGCTTCGACGTCCTGCGCGACCAGCTGATCACGCGCCGGGCCGACGCCGTCCAGCGC.........CGCGCCGATGTCGCCATCATCGACGAGGCGGACTCCGTGCTTGTCGACGAAGCCCTCGTCCCCCTCGTCCTCGCCGGC...XXXXXXXXX...XXXXXXXXXXXX...XXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......................................................................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.................................XXX...XXXXXXXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXX.........XXX...XXX...XXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCCAAGGAGGGGCTCGCCGTCACCGAGGGCGGCCGCATCCTCGACACCATCACCCTC...CAGGCACTGGTGGGCCGATACCCCATGGTCTGTGGCATGACCGGCACCGCCGTCGAAGCCACCGACCAGCTGCGC
TRN  11011101101011011
//