EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07511 - DUF1525)
FAM  PF07511
PID  DUF1525
DES  Protein of unknown function (DUF1525)
IPR  IPR011090
ANO  5
ALN  119
AID  0.459517
APH  ((Q8PK93_XANAC/11-128:0.44497,(Q8GPV0_PSEAE/28-144:0.22551,Q8GQ66_PSEAE/31-147:0.19889):0.16635):0.17204,Q83Z36_PSESX/28-144:0.49049,Q8Z1J0_SALTI/14-128:0.78414);
ATP  ((Q8PK93_XANAC/11-128,(Q8GPV0_PSEAE/28-144,Q8GQ66_PSEAE/31-147)),Q83Z36_PSESX/28-144,Q8Z1J0_SALTI/14-128);
ATL  2.48239
DNO  5
DLN  357
DID  0.522369
DPH  (((Q8PK93_XANAC/11-128:0.31386,Q8Z1J0_SALTI/14-128:0.65184):0.09692,Q83Z36_PSESX/28-144:0.45927):0.08833,Q8GPV0_PSEAE/28-144:0.20252,Q8GQ66_PSEAE/31-147:0.23690);
DTP  (((Q8PK93_XANAC/11-128,Q8Z1J0_SALTI/14-128),Q83Z36_PSESX/28-144),Q8GPV0_PSEAE/28-144,Q8GQ66_PSEAE/31-147);
DTL  2.04964
RID  0.459517
RPH  ((Q8PK93_XANAC/11-128:0.44497,(Q8GPV0_PSEAE/28-144:0.22551,Q8GQ66_PSEAE/31-147:0.19889):0.16635):0.17204,Q83Z36_PSESX/28-144:0.49049,Q8Z1J0_SALTI/14-128:0.78414);
RTP  ((Q8PK93_XANAC/11-128,(Q8GPV0_PSEAE/28-144,Q8GQ66_PSEAE/31-147)),Q83Z36_PSESX/28-144,Q8Z1J0_SALTI/14-128);
RTL  2.48239
LNK  Q83Z36_PSESX/28-144:Q83Z36:AY253671
LNK  Q8GPV0_PSEAE/28-144:Q8GPV0:AF440524
LNK  Q8GQ66_PSEAE/31-147:Q8GQ66:AF440523
LNK  Q8PK93_XANAC/11-128:Q8PK93:AE011865
LNK  Q8Z1J0_SALTI/14-128:Q8Z1J0:AL627282
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8GQ66_PSEAE/31-147
ASQ  AAFAADVVVVTDSRHP-VKTMGGERLIELDRASGLEAELSADLPADPERAAAIVRQRLNQG-GTDLQRRIGTAYQGITDAWSLGVTTIPAVVVDQRYVVYGEPDVARAVSCIEQHRRRQ
DSQ  GCCGCGTTCGCCGCCGACGTGGTGGTCGTCACCGACAGCCGCCACCCG---GTCAAGACCATGGGCGGCGAGCGGCTGATCGAGCTGGACCGGGCATCCGGGCTCGAAGCAGAGCTTTCCGCAGATCTGCCAGCCGACCCCGAGCGCGCAGCAGCCATCGTCCGGCAACGCCTGAACCAAGGC---GGCACCGACCTTCAGCGCCGCATTGGCACCGCCTACCAGGGCATCACCGACGCATGGAGTTTGGGTGTCACGACCATCCCGGCCGTCGTGGTGGACCAACGCTATGTGGTCTATGGCGAGCCTGACGTGGCCCGGGCCGTGTCCTGCATCGAGCAGCACCGGAGGAGGCAA
TRN  10010101100011011
NAM  Q8GPV0_PSEAE/28-144
ASQ  LAQAAEILVVTDSRHP-VQATSDARLIELDQPARIEAELGAHLPADPSHGAALVQQRLNSG-GVELQQRLGAAYQGVVNAWSLGVTTIPAVIVDHRYVVYGEPDVAKAVALIEAHRRTQ
DSQ  TTGGCGCAGGCCGCTGAAATACTGGTCGTCACCGATAGCCGGCACCCG---GTGCAAGCCACCAGCGATGCCCGGCTGATCGAGCTGGATCAACCCGCACGTATCGAGGCCGAGCTGGGGGCGCATTTACCTGCCGATCCCTCGCATGGCGCCGCCCTGGTGCAACAGCGCTTGAACAGCGGC---GGCGTCGAGCTGCAACAACGCCTCGGCGCGGCCTATCAGGGGGTGGTCAATGCCTGGAGCCTCGGCGTGACAACGATTCCTGCGGTGATCGTGGATCACCGTTATGTGGTTTATGGCGAGCCGGACGTCGCCAAGGCGGTCGCGCTCATCGAAGCGCACCGGAGGACGCAG
TRN  10010101100011010
NAM  Q8PK93_XANAC/11-128
ASQ  TAFAADVQVFTDRAHP-VAAAPGTTVVELDAPARLIAELGADLPADPRRAESLLRQRLASPKQRDLQSRIAQAYQRVADAYHLGVAKLPAVVVDGRYVVYGDANVGRAVARIAGHRNAR
DSQ  ACCGCGTTCGCCGCCGATGTTCAGGTGTTCACCGACCGTGCCCATCCG---GTCGCCGCGGCCCCTGGCACGACCGTCGTTGAACTGGACGCCCCCGCACGCCTGATCGCCGAGCTCGGCGCGGACCTGCCGGCCGATCCCCGGCGCGCAGAATCCCTGCTGCGCCAGCGCCTGGCGTCTCCAAAGCAGCGGGACTTGCAATCGCGGATCGCCCAGGCGTACCAGCGCGTGGCCGACGCGTACCATCTGGGCGTCGCCAAGCTCCCCGCGGTGGTGGTCGATGGGCGTTACGTCGTCTATGGCGACGCGAACGTGGGGCGCGCCGTCGCCCGCATTGCCGGTCACCGGAATGCCCGG
TRN  11011111101111111
NAM  Q83Z36_PSESX/28-144
ASQ  F-SSAETSIVTDRNHP-VQTPAHVRLILLDESERLEAKLSEGLPANQQQAISIMQQRLKSSDAQRLQRDLALAQQDLVDAWSMGVTKVPAVVVDRKFVVYGETNATAAEYRIVQWRTAA
DSQ  TTC---TCGAGCGCGGAGACGTCGATCGTTACTGACCGGAACCATCCA---GTCCAGACACCGGCACATGTCCGGCTGATCCTCCTGGACGAATCAGAACGACTTGAGGCCAAGCTCTCTGAAGGACTGCCGGCGAATCAGCAACAAGCCATCTCAATCATGCAGCAACGCCTCAAGAGCAGCGATGCGCAGCGCTTGCAACGAGATCTGGCATTGGCTCAACAAGACCTAGTAGACGCCTGGAGCATGGGGGTAACGAAGGTGCCTGCTGTGGTGGTCGACCGCAAGTTTGTGGTGTACGGGGAAACGAACGCTACGGCGGCTGAATATCGCATTGTCCAGTGGCGCACCGCCGCC
TRN  11011111101111101
NAM  Q8Z1J0_SALTI/14-128
ASQ  FSASAQIVVYTDQGHPPVGVTPAIRVVYLDASERWLQQQFGELSSDPEQAVRQAHSLLNSPDWKRRQKALIEHYRGMIEAWQLGLLKYPAVVFDNRDVVYGTVDISRAVAL----RRGE
DSQ  TTTTCTGCAAGTGCGCAAATCGTTGTTTACACCGACCAGGGGCATCCTCCGGTCGGTGTAACACCGGCTATCCGGGTTGTTTATCTCGATGCCAGCGAACGCTGGCTGCAGCAACAATTTGGAGAGCTTTCTTCTGATCCTGAACAGGCTGTCAGACAGGCTCATTCTCTGCTGAATTCTCCTGACTGGAAGAGACGGCAAAAAGCGCTTATCGAACATTACAGGGGAATGATTGAAGCATGGCAGCTTGGTTTACTGAAATATCCGGCGGTGGTTTTTGACAACCGTGACGTGGTTTACGGGACTGTTGATATATCCCGGGCAGTGGCGCTG------------CGCAGGGGAGAG
TRN  10010101100011010
//