EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07454 - SpoIIP)
FAM  PF07454
PID  SpoIIP
DES  Stage II sporulation protein P (SpoIIP)
IPR  IPR010897
ANO  9
ALN  296
AID  0.360565
APH  ((((((O87702_BACME/80-361:0.39672,(Q9KBM3_BACHD/90-369:0.42058,Q8EPW1_OCEIH/94-372:0.38990):0.13441):0.06438,SP2P_BACSU/101-383:0.31543):0.68558,Q8R9I5_THETN/52-292:1.07219):0.42411,Q8XIS4_CLOPE/80-354:0.56778):0.13474,Q97JJ8_CLOAB/86-350:0.42169):0.36530,Q892Q3_CLOTE/87-344:0.08339,Q892Q4_CLOTE/87-346:0.16389);
ATP  ((((((O87702_BACME/80-361,(Q9KBM3_BACHD/90-369,Q8EPW1_OCEIH/94-372)),SP2P_BACSU/101-383),Q8R9I5_THETN/52-292),Q8XIS4_CLOPE/80-354),Q97JJ8_CLOAB/86-350),Q892Q3_CLOTE/87-344,Q892Q4_CLOTE/87-346);
ATL  5.66098
DNO  9
DLN  888
DID  0.486544
DPH  ((Q9KBM3_BACHD/90-369:0.26557,((Q8XIS4_CLOPE/80-354:0.32798,((Q892Q3_CLOTE/87-344:0.11654,Q892Q4_CLOTE/87-346:0.08017):0.22223,Q97JJ8_CLOAB/86-350:0.29357):0.09904):0.31539,Q8R9I5_THETN/52-292:0.53226):0.35634):0.09690,Q8EPW1_OCEIH/94-372:0.29589,(O87702_BACME/80-361:0.32273,SP2P_BACSU/101-383:0.31694):0.07724);
DTP  ((Q9KBM3_BACHD/90-369,((Q8XIS4_CLOPE/80-354,((Q892Q3_CLOTE/87-344,Q892Q4_CLOTE/87-346),Q97JJ8_CLOAB/86-350)),Q8R9I5_THETN/52-292)),Q8EPW1_OCEIH/94-372,(O87702_BACME/80-361,SP2P_BACSU/101-383));
DTL  3.71879
RID  0.360565
RPH  ((((((O87702_BACME/80-361:0.39672,(Q9KBM3_BACHD/90-369:0.42058,Q8EPW1_OCEIH/94-372:0.38990):0.13441):0.06438,SP2P_BACSU/101-383:0.31543):0.68558,Q8R9I5_THETN/52-292:1.07219):0.42411,Q8XIS4_CLOPE/80-354:0.56778):0.13474,Q97JJ8_CLOAB/86-350:0.42169):0.36530,Q892Q3_CLOTE/87-344:0.08339,Q892Q4_CLOTE/87-346:0.16389);
RTP  ((((((O87702_BACME/80-361,(Q9KBM3_BACHD/90-369,Q8EPW1_OCEIH/94-372)),SP2P_BACSU/101-383),Q8R9I5_THETN/52-292),Q8XIS4_CLOPE/80-354),Q97JJ8_CLOAB/86-350),Q892Q3_CLOTE/87-344,Q892Q4_CLOTE/87-346);
RTL  5.66098
LNK  O87702_BACME/80-361:O87702:AJ000758
LNK  Q892Q3_CLOTE/87-344:Q892Q3:AE015943
LNK  Q892Q4_CLOTE/87-346:Q892Q4:AE015943
LNK  Q8EPW1_OCEIH/94-372:Q8EPW1:BA000028
LNK  Q8R9I5_THETN/52-292:Q8R9I5:AE013117
LNK  Q8XIS4_CLOPE/80-354:Q8XIS4:BA000016
LNK  Q97JJ8_CLOAB/86-350:Q97JJ8:AE007640
LNK  Q9KBM3_BACHD/90-369:Q9KBM3:BA000004
LNK  SP2P_BACSU/101-383:P37968:D17650
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8R9I5_THETN/52-292
ASQ  VHKKDMYLSGDNKLYEIVEVDEGEKIAYAKYIRTEKLPDV---------------------------DEEVSAAIAVSQNTGEKRIAIYSTHSDESYLP--SDGAASI-------NGHGGIYRVDTALQKALEDK-GVKVKVDWT-------LYLPHDAMAYTRSRAGAVKLLKEFK-PDLLLDVHRD.AVPLEEY---.IRKIAGKNAAGVRIVLGRNNPNLKANQNLAYRIKAIADKTYPHLIKDIF-----FGEGDFNQDLTPNALLLEFGTYPHTRQRAEVSAGFMADVLTK
DSQ  GTGCACAAAAAAGACATGTACCTTTCAGGGGATAACAAGCTGTACGAAATAGTGGAGGTAGATGAAGGAGAGAAAATTGCTTATGCCAAGTACATACGGACGGAAAAGCTTCCAGATGTG---------------------------------------------------------------------------------GATGAAGAAGTTTCTGCTGCGATAGCTGTATCGCAAAACACAGGTGAAAAAAGGATAGCAATATACTCCACTCACAGTGACGAATCTTACTTGCCA------TCTGACGGCGCTGCTAGCATT---------------------AATGGACACGGAGGAATATACAGGGTAGATACTGCTCTTCAGAAAGCATTGGAAGACAAA---GGAGTAAAGGTAAAAGTGGATTGGACC---------------------TTGTACCTTCCCCACGATGCCATGGCATATACCCGCTCAAGGGCAGGGGCTGTGAAATTGCTGAAAGAATTTAAG---CCAGATCTCCTTTTAGATGTCCATAGAGAT...GCTGTTCCTTTGGAGGAATAC---------...ATAAGGAAAATTGCAGGTAAAAATGCTGCAGGAGTGAGAATTGTCCTTGGGAGGAATAACCCCAATTTAAAAGCTAATCAAAATCTGGCGTATAGGATTAAAGCCATTGCCGACAAAACTTATCCTCACCTTATAAAAGACATATTT---------------TTTGGAGAAGGAGACTTCAATCAGGACCTGACTCCCAATGCTCTTCTTTTAGAATTTGGGACATACCCTCACACGAGGCAAAGGGCAGAAGTTTCAGCAGGGTTTATGGCAGATGTCCTTACAAAA
TRN  10010101100011000
NAM  Q8EPW1_OCEIH/94-372
ASQ  LQPSDPRSLLGNELPGFSIYDSQILMASGDNHFTSFPIESNPPLEE---VLKDREA----VVEDDVDEELPPEEDIEQTTGDRDVVFLYTTHNRESFLP--HLPGVEDPNSAM--HAEINISKVSERLGQSLERK-GIGTYVDNTDFGQQLNEQGKKYHQSYEVSREAVETAFSGNKDIQYVFDLHRD.ALRRDKT---.TIEIEGESYAKLIFVVGTAHENYEENMKTATELNALIEEKYPGLSRGIYPKDGSNGNGVYNQDVSGNALLVEFGGVDNTMEELYRSADALAEVFSE
DSQ  TTACAACCAAGTGATCCAAGGAGTCTATTAGGGAATGAATTACCTGGTTTTTCCATATATGATAGTCAAATTCTAATGGCAAGCGGTGATAATCATTTTACAAGTTTTCCTATTGAATCTAATCCTCCTTTGGAAGAA---------GTGTTGAAGGATAGAGAAGCT------------GTTGTAGAAGATGACGTTGATGAAGAGCTTCCTCCAGAAGAAGATATAGAGCAAACTACTGGTGATCGAGATGTTGTGTTTCTCTATACAACACATAATCGAGAATCGTTTTTACCA------CATTTGCCAGGTGTGGAAGATCCTAACTCTGCGATG------CATGCCGAGATTAATATTTCTAAAGTCAGTGAACGACTAGGACAATCTTTAGAACGAAAA---GGTATTGGTACTTATGTCGATAATACAGATTTTGGTCAACAACTAAATGAACAAGGGAAAAAATATCACCAGTCCTATGAAGTATCTCGAGAAGCAGTAGAAACAGCATTTTCTGGAAATAAAGATATTCAGTATGTATTTGACTTACATCGTGAT...GCGTTACGTAGGGATAAAACA---------...ACTATAGAAATTGAAGGCGAAAGCTATGCCAAACTGATTTTTGTAGTTGGAACAGCACATGAAAATTACGAAGAAAATATGAAAACTGCTACAGAGTTAAATGCACTTATTGAAGAAAAATATCCTGGATTAAGTAGAGGTATTTATCCAAAAGATGGATCAAATGGAAATGGTGTATATAATCAAGATGTTTCTGGTAATGCACTATTAGTTGAATTTGGGGGAGTAGACAACACGATGGAAGAACTTTATCGATCCGCTGATGCGTTAGCTGAAGTATTTAGTGAA
TRN  10010101100011000
NAM  Q9KBM3_BACHD/90-369
ASQ  IEMGDIRSLLGRELPGLALFDTRIIVAGEGTNLSNMPFESPPPMEV---LLEEREAVMESSDEEEADTE---STPDTERQTDSTRVFIHHTHSWESFLP--HLPGVENPNQAT--HNEMNIIKVGERLGDALEKH-GIQAAVDKTDMTALLHERNVRPSRAYEVSREIVQEAIKEHDDLSFIFDLHRD.SVRRDDT---.TVTINGKEYAQVLFVIGESHPDYEKNLELATKLHEKVEEKYPGLSRGVFGRDRSSGNGVYNQDLSDQSILIEFGGVDNHIDELNRSADAFAEVFAD
DSQ  ATTGAAATGGGGGACATTCGTTCACTGCTCGGACGAGAGTTGCCTGGTTTAGCTCTTTTTGATACACGTATTATCGTTGCAGGGGAAGGGACAAATCTTTCGAACATGCCTTTCGAATCACCGCCACCGATGGAAGTG---------TTGTTGGAAGAACGAGAAGCGGTCATGGAGTCTTCAGATGAAGAAGAAGCTGATACTGAA---------TCTACACCAGATACAGAGCGGCAAACGGACAGCACACGTGTGTTTATCCATCATACCCATAGCTGGGAATCGTTTTTGCCT------CATTTGCCAGGTGTGGAAAACCCAAATCAAGCGACG------CACAATGAGATGAATATTATTAAGGTGGGTGAACGCTTAGGGGATGCCCTTGAAAAACAC---GGAATTCAGGCAGCTGTCGACAAAACCGATATGACCGCATTGCTTCATGAGCGCAATGTTCGTCCGAGTCGGGCGTATGAAGTATCACGAGAAATTGTTCAAGAAGCGATTAAGGAACACGATGACCTCTCATTTATTTTTGATCTTCACCGAGAC...TCCGTACGAAGGGATGATACA---------...ACGGTTACTATTAATGGGAAAGAATATGCGCAAGTGTTGTTTGTCATCGGTGAATCCCATCCTGATTATGAGAAAAATTTAGAGCTTGCGACAAAACTGCATGAAAAAGTGGAAGAAAAATATCCAGGACTCAGTCGCGGTGTGTTTGGTCGGGATCGCTCAAGCGGAAATGGCGTCTACAATCAAGATCTCTCTGACCAATCGATCTTAATTGAATTTGGCGGTGTCGATAACCATATTGACGAGCTAAATCGTAGCGCCGACGCATTTGCCGAAGTGTTTGCTGAT
TRN  10010101100011000
NAM  SP2P_BACSU/101-383
ASQ  INLEDPRSFLGRELPGFAQFDTEILLAGQGTDYTNMPAESPPPSKV---MEEEREANLAEIEKQQTQSDNAQKDPPKQTTGDKKVVFIYHTHNTESYLP--LLKGETDPDMAR--HSKANVTLVGDMFGQALESQ-GIGATVNKTDIQSKLNKKGLNYARSYDESRPVVKDALASNKNLQYIIDIHRD.SRRKKDT---.TATIKGKSYARVAFVVGKKSKNFEENYKIASELHKLMEKKYPGLSTGVFSKGSPGDNGVYNQDLTDRALLLEFGGVDNNLEELQRAANAAADVFSE
DSQ  ATTAACCTCGAAGATCCGCGGAGCTTTCTCGGTCGGGAGCTGCCAGGATTTGCACAATTTGATACCGAGATTTTGTTAGCTGGACAAGGAACGGATTATACGAATATGCCTGCGGAATCGCCGCCGCCGTCTAAGGTG---------ATGGAGGAAGAAAGAGAAGCGAATTTGGCAGAGATTGAAAAACAGCAAACGCAATCAGATAATGCGCAAAAAGATCCGCCGAAACAAACAACAGGTGATAAAAAGGTCGTGTTTATCTATCACACGCACAATACGGAATCATATCTCCCT------CTATTAAAAGGCGAGACCGATCCTGACATGGCGCGC------CATTCTAAAGCCAATGTCACGCTTGTAGGAGATATGTTCGGACAAGCGCTTGAATCCCAG---GGAATCGGAGCCACAGTGAATAAAACCGATATACAGTCAAAATTGAATAAAAAAGGCTTAAACTATGCCAGGTCCTATGATGAATCAAGGCCGGTCGTGAAAGACGCCCTCGCTTCAAACAAAAATCTGCAATATATCATTGACATCCACAGAGAC...TCTCGGCGCAAAAAAGACACA---------...ACCGCAACGATTAAAGGGAAAAGCTATGCCAGGGTAGCCTTTGTCGTCGGGAAAAAAAGCAAAAACTTCGAAGAAAACTATAAAATTGCGAGTGAGCTTCATAAACTGATGGAGAAAAAATACCCCGGACTTAGCACAGGTGTCTTTTCCAAAGGCTCGCCAGGCGATAATGGTGTTTACAATCAGGATTTAACCGATAGAGCGCTTTTGCTCGAGTTTGGCGGAGTGGATAATAATCTCGAAGAGCTGCAGCGTGCGGCTAACGCGGCCGCGGACGTATTCAGCGAA
TRN  10010101100011000
NAM  O87702_BACME/80-361
ASQ  IRAEDARSLFGSELPGFSIYDSNIIIAGEGTNFTNFPRESAPPLDE---TLKERNST---TKVQQPKENDGTNAPNNNTTGGKKVFYIYHTHSWESYLP--LLGLEGDPDANKAVDSKTNINMVANMLGKDLEAQ-GIGAEVDQTNIGQKLKEKGWNTNQSYAMSRTVIETALTENRDLTYFIDLHRD.SLRKDNT---.TIKINNKSYAKVVFVLGKANQNFEQNLKMAKALHEGLEKKYPGLSRGVIGKNKSSGNGVYNQDVSRNAILIEVGGVDNNFDELTNTTKALSDVISQ
DSQ  ATTCGAGCAGAAGACGCGAGAAGCTTGTTTGGTTCAGAACTTCCTGGATTCAGTATTTACGACTCCAATATTATCATCGCCGGTGAAGGCACAAATTTCACAAACTTCCCTAGAGAATCCGCACCACCGTTAGATGAA---------ACGCTAAAAGAAAGAAATTCTACT---------ACAAAAGTTCAGCAACCTAAAGAAAACGATGGTACGAATGCTCCAAATAATAATACAACTGGCGGAAAAAAGGTATTTTATATTTATCATACGCACAGCTGGGAATCTTACTTGCCT------CTGTTAGGACTTGAAGGTGATCCAGATGCTAATAAAGCAGTAGATAGCAAAACAAATATTAATATGGTCGCAAATATGCTAGGAAAAGATTTAGAGGCTCAG---GGAATTGGGGCAGAAGTAGATCAAACCAATATTGGACAGAAATTAAAAGAAAAAGGTTGGAACACCAATCAATCGTACGCCATGTCTCGCACAGTAATTGAAACGGCGTTGACTGAGAATAGAGATTTAACTTACTTTATCGATTTGCACCGAGAT...TCGCTTCGAAAAGATAATACA---------...ACCATTAAGATTAACAATAAATCGTATGCAAAAGTTGTGTTTGTTTTAGGGAAAGCGAATCAAAACTTTGAACAAAACTTAAAAATGGCAAAAGCGCTTCATGAAGGTCTTGAAAAGAAATATCCTGGGTTAAGCCGCGGAGTTATTGGCAAAAACAAATCCAGCGGTAACGGTGTATATAATCAGGATGTTTCTAGAAATGCGATTTTAATTGAAGTGGGCGGAGTTGATAATAACTTTGATGAACTAACCAACACAACAAAAGCACTGTCTGATGTCATTAGCCAA
TRN  10010101100011000
NAM  Q892Q4_CLOTE/87-346
ASQ  IKLEDPLTVLEKEISLINTSEI--------YKQKDYELEPFKLDEK-------YVLKEE--VKKEINKKIHNPNLKKKLDKSKPEIFIYHTHATESYKP--ENNFSL--------DMNKNICIVGDILTKELEDNYGISVIHDKT------LHDANAYTRSYERSGVTVDKYLKKYGDFKLIIDLHRD.GVKNTKLIEPfITSINGEKVAKIMFVLAKDNPHYSENLKVANSLLDISSRVFPGFCKPHR--CYDHVTRHFHQNKSNNSVLIEVGANSNNLQDAKNSAKYLARIIGE
DSQ  ATAAAATTAGAAGATCCTTTAACAGTTCTAGAAAAGGAAATTTCACTTATTAATACAAGTGAAATA------------------------TATAAGCAAAAAGATTATGAACTTGAACCTTTTAAGTTAGACGAAAAA---------------------TATGTTTTAAAAGAAGAG------GTTAAAAAGGAAATAAATAAAAAGATTCATAATCCTAATTTAAAAAAGAAATTAGATAAAAGTAAACCAGAAATTTTTATTTATCATACTCATGCAACGGAAAGTTATAAACCA------GAAAATAATTTTTCATTA------------------------GATATGAATAAAAATATTTGTATAGTGGGCGACATTTTAACAAAAGAGCTGGAAGATAACTATGGAATATCGGTAATACATGATAAAACA------------------CTTCACGATGCAAATGCATATACTAGAAGTTATGAAAGATCAGGAGTAACTGTGGATAAATATTTAAAAAAATATGGGGATTTTAAGCTTATAATAGATTTGCATAGAGAT...GGAGTAAAAAATACTAAATTGATTGAACCAtttATAACTAGTATAAATGGAGAAAAAGTCGCGAAAATAATGTTTGTATTGGCAAAAGATAATCCGCATTATAGTGAAAATTTAAAAGTTGCAAATAGCTTATTAGATATTTCTAGTAGGGTCTTCCCTGGATTTTGCAAGCCACACCGT------TGTTATGATCATGTTACAAGGCATTTTCATCAAAACAAGAGTAATAATTCTGTATTAATAGAAGTTGGTGCTAATAGTAACAATTTACAAGATGCTAAGAATTCAGCAAAGTATTTAGCAAGAATTATTGGAGAA
TRN  10010101100011000
NAM  Q892Q3_CLOTE/87-344
ASQ  IKPEEPLTILGKEMAFIDTNEV--------YN-TDYKLHPFKLDEK-------YVLKEEKVVTKELNKKIHNPSLKKRLDKSKPEVFIYHTHATESYKP--EENFSL--------DLNKTVCAVGDILTKELEDNYGISVIHDKT------VHDANAYAMSYERSGVTVDKYLKKYGDFKLVIDLHRD.GLDNPKAV--.TTNINGENVAKIMFVLAQKNPHYKENLKVANSLSEISNKLFPGFYRSHH--YYGYGTKYFHQNKSNNSVLIEVGANSNNLQDAKNSAKYLARIIGE
DSQ  ATAAAACCAGAAGAACCTCTAACAATTTTAGGAAAGGAAATGGCATTTATAGACACAAATGAAGTA------------------------TATAAT---ACAGATTATAAGCTTCATCCTTTTAAATTAGATGAAAAA---------------------TATGTTTTAAAAGAAGAAAAAGTTGTTACTAAAGAACTTAATAAGAAGATTCACAACCCTAGTTTAAAAAAGAGATTAGATAAAAGCAAACCAGAAGTTTTTATTTATCATACTCATGCAACGGAAAGTTACAAACCA------GAGGAGAATTTCTCTTTA------------------------GATTTAAATAAAACAGTTTGTGCAGTAGGAGACATTTTAACAAAAGAATTAGAAGATAACTATGGAATATCTGTAATACATGACAAAACA------------------GTTCATGATGCCAATGCTTATGCTATGAGTTACGAAAGATCAGGAGTGACTGTAGATAAATATTTAAAAAAATATGGAGACTTTAAACTTGTAATAGATTTACACAGAGAT...GGGTTAGATAATCCCAAGGCGGTT------...ACAACTAATATAAATGGAGAAAATGTTGCAAAAATAATGTTTGTATTGGCTCAAAAAAATCCTCATTATAAAGAAAATTTAAAGGTCGCAAATAGTTTATCAGAAATTTCAAATAAACTTTTTCCTGGATTTTATAGATCTCATCAC------TATTATGGTTATGGAACAAAATACTTTCATCAAAACAAGAGCAATAATTCTGTATTAATAGAAGTGGGTGCTAATAGTAACAATTTACAAGATGCTAAGAATTCAGCAAAATATTTAGCAAGAATCATTGGGGAA
TRN  10010101110011000
NAM  Q97JJ8_CLOAB/86-350
ASQ  LDINKPENVISKEVSFLGEALPK-------SIKSECPNESFTLDDK--DVVKSTSGSVQNEPLKNINENIYDPKLKKALDKSKPEILIYHSHTTEAYKPYPADSL----------NSTQNVCAVGDELVKELGEKYGIYAINDKT------VHNVVDYNKSYTRSGETLDKYLKQYGDFKMIIDMHRDsDVPKSKV---.TARINGEDVAKFMFVMTRKNPHFDKNMALVNGLVSICNKDFPGIFNGIY--YYDYGINYYNQQKSNNAFLLEVGSDINTIDEAKGTSKYLARIIAE
DSQ  CTTGATATAAATAAGCCTGAAAATGTAATATCTAAAGAAGTATCATTTTTAGGTGAGGCATTGCCTAAG---------------------TCTATAAAAAGTGAATGCCCTAATGAAAGCTTTACTTTAGATGATAAA------GATGTGGTTAAGAGTACAAGTGGTTCTGTTCAAAATGAACCCTTAAAAAATATAAATGAAAATATTTATGATCCTAAATTAAAAAAGGCACTTGATAAATCAAAGCCTGAAATTTTAATATATCATTCACATACAACAGAAGCATATAAGCCATATCCAGCAGATTCTTTG------------------------------AATTCAACTCAAAATGTATGTGCGGTGGGCGATGAACTTGTTAAGGAACTGGGAGAGAAATATGGTATATATGCTATAAATGATAAAACA------------------GTTCATAATGTGGTTGATTATAATAAAAGTTATACGCGTTCAGGTGAAACACTTGATAAGTATTTAAAGCAGTATGGCGATTTTAAAATGATAATAGATATGCATAGAGATtctGATGTGCCTAAAAGTAAAGTT---------...ACTGCTAGAATAAATGGTGAAGATGTAGCTAAATTTATGTTTGTCATGACAAGAAAAAATCCGCATTTTGATAAGAATATGGCTCTTGTTAATGGACTTGTATCAATATGCAATAAGGATTTTCCTGGTATATTTAATGGGATATAT------TATTATGATTATGGAATAAATTATTACAATCAACAAAAAAGTAATAATGCATTTTTGTTAGAGGTAGGCTCAGATATAAACACAATTGATGAGGCTAAGGGAACTTCTAAATATTTAGCAAGAATTATTGCAGAA
TRN  10010101100011000
NAM  Q8XIS4_CLOPE/80-354
ASQ  IKPLDPIELVMNEVPYFGAVNKIASIDKVNYVSAEKVS-SFDLNKDSIDIVSEEESKESAELEASKNSEVYDPSLKKELDQSKPEVLIYHTHNSEGYTE--ERTSN---------NEEHNVVGVGTLVAKELEENYGISVIHDKT-------NHSASYEQSYNKSRETVKKYINEYDDFKMVIDIHRD.SVGEHNKKNL.TANINGESLAKIMFVTTKNSQYFNDAESLAYRFINKANELFPDILRRQETFKYDRGKNAFNQQYNKNSMLIEVGAEVNTSKEAQATAKYIARLIAE
DSQ  ATAAAGCCTCTAGATCCGATAGAGTTAGTAATGAATGAAGTGCCTTACTTTGGTGCAGTAAATAAAATAGCTTCAATTGATAAAGTTAATTATGTTTCTGCTGAAAAAGTATCT---TCATTTGATTTAAACAAAGATAGTATAGATATAGTTTCTGAGGAAGAATCTAAGGAAAGTGCAGAATTAGAAGCTAGTAAAAATAGTGAAGTTTATGATCCAAGTTTAAAAAAGGAACTAGATCAGTCTAAGCCAGAGGTGCTTATTTATCATACTCATAATTCAGAGGGGTATACTGAG------GAGAGAACTTCAAAC---------------------------AATGAAGAACATAACGTAGTTGGAGTAGGAACTTTAGTTGCAAAAGAACTTGAAGAAAACTATGGTATATCAGTTATTCATGATAAAACA---------------------AATCACTCAGCTTCATATGAGCAATCTTACAATAAATCTAGAGAGACAGTTAAAAAATATATTAATGAATATGATGATTTTAAGATGGTAATAGATATTCATAGAGAT...TCTGTTGGAGAGCATAACAAAAAGAATTTA...ACTGCTAATATAAATGGAGAAAGTTTAGCTAAGATTATGTTTGTTACAACTAAGAATAGCCAATATTTTAATGATGCTGAATCCTTGGCCTATAGATTTATTAATAAAGCCAATGAGCTTTTTCCTGATATTTTAAGAAGACAGGAAACCTTTAAGTATGATAGGGGAAAAAATGCGTTTAACCAACAATATAATAAGAATTCAATGCTTATTGAAGTTGGTGCAGAAGTAAATACTTCTAAAGAGGCTCAAGCTACAGCAAAGTATATAGCTAGATTAATAGCAGAA
TRN  10010101110011000
//