EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07449 - HyaE)
FAM  PF07449
PID  HyaE
DES  Hydrogenase-1 expression protein HyaE
IPR  IPR010893
ANO  9
ALN  114
AID  0.351605
APH  (((((HOXO_AZOVI/5-110:0.70894,(HUPG_RHILV/5-115:0.49833,HUPG_BRAJA/5-115:0.48013):0.14861):0.10009,HUPG_RHOCA/19-126:0.83541):0.09369,(P95498_9PSED/22-128:0.31825,HOXO_ALCEU/21-129:0.26012):0.30221):0.52275,Q8XGC7_SALTI/12-114:0.75257):0.40803,HYAE_ECOLI/10-116:0.19869,Q8Z693_SALTI/10-116:0.10414);
ATP  (((((HOXO_AZOVI/5-110,(HUPG_RHILV/5-115,HUPG_BRAJA/5-115)),HUPG_RHOCA/19-126),(P95498_9PSED/22-128,HOXO_ALCEU/21-129)),Q8XGC7_SALTI/12-114),HYAE_ECOLI/10-116,Q8Z693_SALTI/10-116);
ATL  5.71772
DNO  9
DLN  342
DID  0.475972
DPH  (((((P95498_9PSED/22-128:0.18039,HOXO_ALCEU/21-129:0.24542):0.19906,HUPG_RHOCA/19-126:0.42152):0.04367,(HOXO_AZOVI/5-110:0.37569,(HUPG_BRAJA/5-115:0.32984,HUPG_RHILV/5-115:0.39513):0.09715):0.05009):0.26652,Q8XGC7_SALTI/12-114:0.56683):0.29028,HYAE_ECOLI/10-116:0.20535,Q8Z693_SALTI/10-116:0.18715);
DTP  (((((P95498_9PSED/22-128,HOXO_ALCEU/21-129),HUPG_RHOCA/19-126),(HOXO_AZOVI/5-110,(HUPG_BRAJA/5-115,HUPG_RHILV/5-115))),Q8XGC7_SALTI/12-114),HYAE_ECOLI/10-116,Q8Z693_SALTI/10-116);
DTL  3.83391
RID  0.351605
RPH  (((((HOXO_AZOVI/5-110:0.70894,(HUPG_RHILV/5-115:0.49833,HUPG_BRAJA/5-115:0.48013):0.14861):0.10009,HUPG_RHOCA/19-126:0.83541):0.09369,(P95498_9PSED/22-128:0.31825,HOXO_ALCEU/21-129:0.26012):0.30221):0.52275,Q8XGC7_SALTI/12-114:0.75257):0.40803,HYAE_ECOLI/10-116:0.19869,Q8Z693_SALTI/10-116:0.10414);
RTP  (((((HOXO_AZOVI/5-110,(HUPG_RHILV/5-115,HUPG_BRAJA/5-115)),HUPG_RHOCA/19-126),(P95498_9PSED/22-128,HOXO_ALCEU/21-129)),Q8XGC7_SALTI/12-114),HYAE_ECOLI/10-116,Q8Z693_SALTI/10-116);
RTL  5.71772
LNK  HOXO_ALCEU/21-129:P31910:M96433
LNK  HOXO_AZOVI/5-110:P40593:M80522
LNK  HUPG_BRAJA/5-115:P48339:L25760
LNK  HUPG_RHILV/5-115:P28149:X52974
LNK  HUPG_RHOCA/19-126:Q03006:Z15089
LNK  HYAE_ECOLI/10-116:P19931:M34825
LNK  P95498_9PSED/22-128:P95498:D86986
LNK  Q8XGC7_SALTI/12-114:Q8XGC7:AE016838
LNK  Q8Z693_SALTI/10-116:Q8Z693:AL627272
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8Z693_SALTI/10-116
ASQ  LWQRLLTR-GWQPVE-ASTVDDWIKR----IGDGVILLSSDPRRTPEVSDNPVMIAELLREFPQFDWQVAVA-DLEQSEAIGDRFNVRRFPATLVFTDGELRGALSGIHPWAEL
DSQ  CTATGGCAACGCCTGTTAACCCGT---GGATGGCAACCGGTAGAG---GCTTCCACGGTAGACGACTGGATCAAACGG------------ATTGGAGATGGCGTCATCCTGTTAAGTAGCGATCCGCGGCGTACGCCGGAAGTCAGCGATAACCCGGTGATGATTGCCGAACTCCTGCGTGAGTTCCCGCAGTTTGACTGGCAGGTGGCGGTGGCC---GACCTTGAACAAAGCGAAGCTATCGGCGATCGCTTTAATGTACGTCGGTTTCCGGCGACGTTGGTTTTTACAGACGGCGAGCTACGCGGCGCGCTCAGCGGCATTCATCCCTGGGCTGAACTG
TRN  11011101101011010
NAM  HYAE_ECOLI/10-116
ASQ  LWQRMLAR-GWTPVS-ESRLDDWLTQ----APDGVVLLSSDPKRTPEVSDNPVMIGELLREFPDYTWQVAIA-DLEQSEAIGDRFGVFRFPATLVFTGGNYRGVLNGIHPWAEL
DSQ  TTGTGGCAACGAATGCTGGCGCGC---GGCTGGACGCCAGTCAGT---GAATCCCGTCTTGACGACTGGCTTACGCAA------------GCGCCAGACGGCGTGGTGTTATTAAGCAGTGACCCGAAACGCACGCCAGAGGTCAGCGATAATCCGGTAATGATTGGCGAATTACTGCGCGAGTTTCCCGACTATACATGGCAGGTGGCGATTGCT---GACCTTGAGCAGAGCGAAGCCATCGGCGATCGCTTTGGCGTCTTTCGCTTTCCTGCCACTTTAGTGTTTACCGGCGGAAACTATCGCGGCGTGCTGAATGGTATTCACCCGTGGGCGGAACTG
TRN  11011101101011010
NAM  Q8XGC7_SALTI/12-114
ASQ  LADK-----GFLVTD-AQTLPSLINA----HPTLLVLLQSDPNKHPEVADSWVIIPEILKQFPATSYTAAFA-DSEQSELIAREYRILKYPALLFFRQHRFVGSLAGLYSWQEY
DSQ  CTGGCGGATAAA---------------GGCTTTCTGGTTACCGAT---GCGCAAACGCTCCCGTCGTTGATTAATGCG------------CATCCGACTCTGCTGGTTTTGCTGCAAAGTGACCCCAACAAACATCCGGAAGTCGCCGACAGTTGGGTCATTATCCCGGAGATCCTCAAGCAATTTCCGGCGACATCTTATACCGCGGCATTTGCG---GATAGCGAACAGAGTGAACTGATCGCCCGGGAGTATCGCATTCTGAAATATCCGGCGCTGCTTTTCTTTCGCCAGCACCGTTTTGTCGGCAGTCTGGCGGGATTATATAGCTGGCAAGAATAC
TRN  11011101101011010
NAM  HOXO_AZOVI/5-110
ASQ  LIQRLTTTLGYPLLD-ADGLDRQVRT----QPFSVLFFAGDPQRFPEALDVAVILPELVKAFPQLAPALIAG---ADEARLQGRYGFSVWPSLVFLAGERYLGCLSRVLDWGEY
DSQ  CTGATCCAGCGTCTGACCACGACGCTCGGCTACCCCCTGCTGGAT---GCCGACGGCCTCGACCGCCAGGTGCGGACG------------CAGCCGTTCTCCGTGCTGTTCTTCGCCGGCGATCCGCAGCGCTTTCCCGAGGCGCTCGACGTCGCGGTGATCCTGCCGGAACTGGTCAAGGCCTTCCCGCAGCTCGCTCCCGCGTTGATCGCCGGC---------GCGGACGAGGCCCGTCTGCAGGGGCGCTACGGTTTCTCCGTCTGGCCGAGCCTGGTGTTCCTCGCGGGGGAGCGCTACCTGGGCTGCCTGTCGCGGGTACTGGACTGGGGCGAATAC
TRN  11011111101111111
NAM  HOXO_ALCEU/21-129
ASQ  VIERLVEQHQAAWVD-QDSIDDWLAG----GGDCVLFIAGDPVRFPECVDVAVVLPELQRVFFNGFRIGVAKREREHEDVLANRFGTQRRPSLVFLRDGAYVSVIAGMRDWDEY
DSQ  GTGATCGAACGTCTGGTCGAACAGCATCAGGCTGCCTGGGTTGAC---CAGGATTCCATTGACGACTGGCTGGCTGGC------------GGCGGCGATTGCGTGCTGTTTATCGCCGGCGACCCGGTGCGCTTTCCCGAGTGCGTGGATGTCGCTGTCGTGTTGCCGGAGTTGCAAAGGGTGTTCTTCAATGGTTTTCGCATTGGCGTGGCGAAACGTGAACGTGAGCACGAAGATGTGCTGGCGAATCGCTTTGGCACGCAGCGTCGACCGTCGCTGGTGTTCTTGCGAGACGGTGCCTATGTGAGCGTAATCGCCGGCATGCGCGACTGGGACGAATAC
TRN  10010101100011011
NAM  P95498_9PSED/22-128
ASQ  LIARLLDQFEAQWVD-PASIDSWLAA----EGFGVLLIAGDPVRFPESLDVAVVLPELRAACGQQFRIGIVR--AEHEEALAARFGARRRPTLVCVRDGGYLGELAGMLDWDDY
DSQ  CTCATAGCCCGTTTGCTCGACCAGTTCGAGGCGCAATGGGTGGAC---CCGGCTTCGATTGACTCCTGGCTGGCCGCC------------GAGGGCTTCGGCGTGTTGCTGATTGCCGGCGACCCGGTACGCTTTCCAGAGTCGCTCGATGTCGCCGTGGTGCTGCCCGAGTTGCGGGCCGCCTGCGGTCAGCAGTTTCGGATCGGCATCGTGCGT------GCCGAGCACGAGGAGGCACTCGCGGCGCGCTTCGGCGCGCGGCGCCGCCCGACGCTGGTCTGCGTGCGCGACGGCGGCTACCTCGGGGAGCTGGCCGGCATGCTCGACTGGGACGATTAC
TRN  10010111100111011
NAM  HUPG_BRAJA/5-115
ASQ  VGKHDLTRHGLNEVD-AATVDHFLGAADEAGAIAVLLSAGDPNRFPEATDVAVVLPELIAAFGGRLRGAVIA--RGDESALGQRFGVRVQPTLIFVAKGETLGLIAKIQDWSVY
DSQ  GTGGGGAAGCATGATCTGACGCGGCACGGCCTGAATGAGGTCGAT---GCCGCGACGGTTGATCATTTTCTTGGCGCAGCAGACGAGGCTGGTGCGATCGCCGTGCTGCTGTCGGCGGGCGATCCCAACCGCTTTCCGGAGGCGACCGACGTCGCCGTGGTGCTGCCAGAGCTGATCGCCGCATTCGGCGGCCGGCTGCGCGGTGCGGTCATCGCG------CGCGGTGACGAGAGCGCGCTCGGCCAGCGTTTTGGCGTCCGCGTGCAGCCGACGCTGATCTTCGTCGCCAAGGGCGAGACACTGGGGCTGATCGCCAAGATCCAGGACTGGTCAGTCTAT
TRN  11011111101111101
NAM  HUPG_RHILV/5-115
ASQ  LVRALNERAHLPVVD-ETNIDAFLAPAAGEPDNAVLFFTGDPAQRPEADDVAVVLPELMQVFRGRLRGAVVR--RATEDKLKARFNVVVMPSLVVTRRDQPVGVLGKIRDWSEY
DSQ  CTGGTCCGCGCCCTGAACGAGCGGGCGCACCTACCTGTCGTCGAT---GAGACGAATATCGATGCCTTCCTCGCCCCGGCTGCGGGCGAGCCCGACAATGCCGTCCTGTTCTTCACCGGCGATCCGGCGCAACGGCCCGAGGCCGATGATGTCGCCGTGGTTCTTCCAGAACTCATGCAGGTCTTCCGTGGCCGCCTGCGGGGCGCGGTGGTTCGC------CGTGCGACGGAGGACAAGCTTAAGGCGCGCTTCAACGTCGTCGTCATGCCGAGCCTCGTCGTGACGCGGCGGGACCAGCCGGTCGGCGTGCTCGGCAAGATCCGCGACTGGTCGGAATAT
TRN  11011111101111111
NAM  HUPG_RHOCA/19-126
ASQ  LVARLTTEFGWPRLENAHDLREFTTR----PGAHCLFVPGDAARNLETPDAAVVLPELRQAFQNAFDCAVVG--DGIETELRETTRVLKTPSFLFFRDGDFLGGIEKIRDWDDY
DSQ  CTGGTGGCCCGGCTGACCACCGAGTTCGGCTGGCCGCGGCTGGAAAACGCGCATGACCTGCGCGAATTCACCACCCGG------------CCGGGGGCGCATTGCCTGTTCGTGCCGGGCGACGCGGCGCGCAATCTGGAAACCCCCGATGCCGCCGTGGTGCTGCCCGAACTGCGCCAGGCCTTTCAGAACGCCTTTGACTGCGCCGTCGTCGGC------GACGGCATCGAGACCGAACTGCGCGAAACCACCCGGGTGCTGAAAACCCCCTCGTTCCTGTTCTTCCGCGACGGCGACTTTCTGGGCGGCATCGAAAAGATCCGCGACTGGGACGATTAC
TRN  11011101101011011
//