EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07444 - Ycf66_N)
FAM  PF07444
PID  Ycf66_N
DES  Ycf66 protein N-terminus
IPR  IPR010004
ANO  6
ALN  84
AID  0.548255
APH  ((YCF66_MESVI/2-85:0.19872,(YCF66_ODOSI/2-85:0.79121,(Q8YYA9_ANASP/15-98:0.20959,Q9F1R5_9CHRO/14-97:0.15228):0.16274):0.09819):0.27295,YCF66_MARPO/2-85:0.25344,Q8MA14_CHAGL/2-85:0.15839);
ATP  ((YCF66_MESVI/2-85,(YCF66_ODOSI/2-85,(Q8YYA9_ANASP/15-98,Q9F1R5_9CHRO/14-97))),YCF66_MARPO/2-85,Q8MA14_CHAGL/2-85);
ATL  2.29749
DNO  6
DLN  252
DID  0.580159
DPH  ((YCF66_ODOSI/2-85:0.41258,(YCF66_MESVI/2-85:0.17107,(YCF66_MARPO/2-85:0.20547,Q8MA14_CHAGL/2-85:0.22971):0.14147):0.12159):0.19981,Q9F1R5_9CHRO/14-97:0.18356,Q8YYA9_ANASP/15-98:0.23042);
DTP  ((YCF66_ODOSI/2-85,(YCF66_MESVI/2-85,(YCF66_MARPO/2-85,Q8MA14_CHAGL/2-85))),Q9F1R5_9CHRO/14-97,Q8YYA9_ANASP/15-98);
DTL  1.89568
RID  0.548255
RPH  ((YCF66_MESVI/2-85:0.19872,(YCF66_ODOSI/2-85:0.79121,(Q8YYA9_ANASP/15-98:0.20959,Q9F1R5_9CHRO/14-97:0.15228):0.16274):0.09819):0.27295,YCF66_MARPO/2-85:0.25344,Q8MA14_CHAGL/2-85:0.15839);
RTP  ((YCF66_MESVI/2-85,(YCF66_ODOSI/2-85,(Q8YYA9_ANASP/15-98,Q9F1R5_9CHRO/14-97))),YCF66_MARPO/2-85,Q8MA14_CHAGL/2-85);
RTL  2.29749
LNK  Q8MA14_CHAGL/2-85:Q8MA14:AF494278
LNK  Q8YYA9_ANASP/15-98:Q8YYA9:BA000019
LNK  Q9F1R5_9CHRO/14-97:Q9F1R5:AB046708
LNK  YCF66_MARPO/2-85:Q32616:X04465
LNK  YCF66_MESVI/2-85:Q9MUQ8:AF166114
LNK  YCF66_ODOSI/2-85:P49837:Z67753
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8MA14_CHAGL/2-85
ASQ  IHMEIGPSTFVGICLIIMGIILYLLKTQKPEVSKEYDLLFSSIGLLSGGILIFQGWRLDPILLLCQILCSGTAIFFVLESLYLR
DSQ  ATTCACATGGAGATTGGTCCAAGTACATTTGTTGGAATATGCCTAATAATTATGGGTATAATTTTATATTTATTGAAAACGCAAAAGCCAGAAGTGTCCAAAGAATATGACTTATTATTTTCATCAATAGGGCTTTTGTCAGGAGGAATTTTAATTTTTCAGGGATGGCGATTAGATCCAATACTTTTATTGTGTCAAATTTTATGTAGCGGTACAGCTATATTTTTTGTATTAGAAAGTTTATATCTACGT
TRN  10010101110011000
NAM  YCF66_MARPO/2-85
ASQ  NHMELGPSTILGVGLIIIGLFLYALKLREPYVSRDYDFFFSCIGLLCGGILFFQGWRLDPILLLSQILLSGTTIFFIAESLYLR
DSQ  AATCATATGGAACTAGGACCTAGTACAATACTAGGCGTTGGATTAATTATAATAGGTCTATTTTTATATGCCCTTAAATTAAGGGAACCTTATGTTTCTAGAGATTATGATTTTTTTTTTTCATGTATTGGATTATTATGTGGAGGAATTCTTTTTTTTCAGGGTTGGCGCTTAGATCCTATTCTTTTATTATCACAAATTTTATTAAGTGGAACAACTATTTTTTTTATTGCAGAAAGTCTTTATTTAAGA
TRN  10010101110011000
NAM  YCF66_MESVI/2-85
ASQ  INIEFGPSTILGIAVVCGGILLYITRTIKPEISRDHDIFFSSVALLIGGILIFQGWRLDPILLFGQMLSTGTALCFIIESLKLR
DSQ  ATTAATATTGAATTTGGTCCCAGTACTATCTTAGGAATAGCAGTAGTGTGCGGAGGCATTCTCTTATATATAACTAGAACGATCAAACCTGAAATTTCTAGAGATCATGATATTTTTTTTTCTTCAGTTGCTCTGTTAATTGGAGGAATCCTTATTTTTCAAGGATGGCGACTAGACCCTATTTTACTTTTTGGACAAATGTTGTCCACTGGCACTGCACTTTGTTTTATTATAGAAAGTTTAAAATTAAGA
TRN  10010101100011000
NAM  Q9F1R5_9CHRO/14-97
ASQ  VNVGLGPAGLLGIGLAVAGALLYFLRSIQPELARDHDIFFAAVALLCGGILFFQGWRLDPILLFGQFLLTGTAAFFAYESIRLR
DSQ  GTTAATGTTGGGCTTGGGCCTGCTGGTCTTTTGGGGATTGGCCTCGCGGTTGCTGGGGCCCTCCTCTATTTCCTGCGCTCGATTCAGCCGGAGTTAGCGCGAGATCATGATATTTTCTTTGCCGCAGTGGCACTCCTATGTGGTGGGATTCTCTTTTTCCAAGGATGGCGCCTCGACCCCATTTTGCTGTTTGGCCAGTTTCTGCTGACGGGCACCGCTGCCTTTTTTGCCTACGAAAGTATTCGTTTGCGG
TRN  11011111101111110
NAM  Q8YYA9_ANASP/15-98
ASQ  VNFGTNSASILGIFLAVAGAALYFLRTVRPELSRDQDIFFAAVGLLCGFILIFQGWRLDPILQFGQLLLVGTTVFFAVESIRLR
DSQ  GTTAATTTTGGAACGAACTCAGCCAGTATTCTAGGAATTTTCCTGGCTGTGGCTGGGGCAGCGCTGTATTTTCTCCGCACTGTGCGTCCGGAACTGTCAAGAGATCAGGATATATTTTTTGCAGCAGTGGGCTTACTGTGCGGTTTCATTCTTATTTTCCAAGGATGGCGGTTAGATCCGATTTTGCAATTTGGTCAGCTGCTTTTAGTGGGTACAACTGTATTTTTTGCGGTTGAAAGTATTCGTCTGCGG
TRN  10010101100011000
NAM  YCF66_ODOSI/2-85
ASQ  INFSFGPNIFLGFILGFGILLLYLLRFVKPEVARDEDLFFVTLGLLYSSILVVHGWRLDPILLFSQVLIIASVLGAGWENIRLR
DSQ  ATAAATTTCAGTTTTGGTCCAAATATTTTCTTAGGTTTTATTTTAGGATTTGGAATATTACTGTTGTATCTTCTTCGATTCGTCAAGCCAGAAGTTGCAAGAGACGAAGATCTTTTTTTTGTGACTCTTGGTTTACTATATAGCTCCATTTTAGTTGTTCATGGATGGCGTTTAGATCCTATTCTATTATTTAGTCAAGTCTTAATTATAGCATCTGTATTAGGTGCAGGTTGGGAAAATATTCGATTACGA
TRN  10010101100011010
//