EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07436 - Curto_V3)
FAM  PF07436
PID  Curto_V3
DES  Curtovirus V3 protein
IPR  IPR009997
ANO  2
ALN  87
AID  0.729412
APH  (O93126_9GEMI/1-87:0.22015,Q68539_9GEMI/2-88:0.12914);
ATP  (O93126_9GEMI/1-87,Q68539_9GEMI/2-88);
ATL  0.34929
DNO  2
DLN  261
DID  0.800766
DPH  (O93126_9GEMI/1-87:0.23587,Q68539_9GEMI/2-88:0.00000);
DTP  (O93126_9GEMI/1-87,Q68539_9GEMI/2-88);
DTL  0.23587
RID  0.729412
RPH  (O93126_9GEMI/1-87:0.27709,Q68539_9GEMI/2-88:0.07220);
RTP  (O93126_9GEMI/1-87,Q68539_9GEMI/2-88);
RTL  0.34929
LNK  O93126_9GEMI/1-87:O93126:X97203
LNK  Q68539_9GEMI/2-88:Q68539:U49907
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O93126_9GEMI/1-87
ASQ  MVCLPDWLFLLFIFSILLQSGTNFYGTFQSGSISRQLSSLSSSIDQLFLKVQQVVYTRYPSRDRGSDPRRRRGLSSIPEGSEEATEA
DSQ  ATGGTCTGTCTACCAGACTGGTTATTTTTGCTATTTATCTTCAGTATTCTTCTGCAATCAGGTACCAACTTTTATGGGACCTTTCAGAGTGGATCAATTTCCAGACAATTATCCAGCCTTTCTAGCAGTATCGACCAGTTGTTTCTTAAGGTACAACAAGTGGTGTATACTAGGTATCCATCAAGAGATAGAGGCTCTGACCCTAGAAGAAGGCGAGGTCTTTCTTCAATTCCAGAAGGAAGTGAAGAAGCTACTGAGGCT
TRN  10010101100011000
NAM  Q68539_9GEMI/2-88
ASQ  MVCLPDWVFLLFIASILLQACTNFYGTFHSGSISKKLSSLVSRFDELFFQIQQVVYTRYPSRSRIVNPRRRGSLSGIPEGGEETVEA
DSQ  ATGGTATGTCTACCAGACTGGGTATTCCTACTATTCATAGCTAGTATTCTTCTACAGGCTTGTACGAATTTTTATGGGACCTTTCACAGTGGGTCAATTTCCAAGAAATTATCCAGCCTTGTTAGCCGTTTCGACGAGTTGTTTTTTCAGATACAACAAGTGGTGTATACTAGGTATCCGTCACGAAGTCGAATCGTTAACCCTAGAAGAAGGGGAAGCCTTTCTGGGATTCCAGAAGGAGGTGAAGAAACTGTTGAAGCG
TRN  10010101110011000
//