EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07433 - DUF1513)
FAM  PF07433
PID  DUF1513
DES  Protein of unknown function (DUF1513)
IPR  IPR010887
ANO  9
ALN  370
AID  0.405984
APH  (((((Q87NF1_VIBPA/10-359:0.16582,Q8D8K7_VIBVU/7-360:0.14804):0.06079,Q9KSI9_VIBCH/10-360:0.30637):0.50547,((Q92SP9_RHIME/9-359:0.16944,Q8UIK8_AGRT5/12-362:0.24318):0.33837,Q98BK7_RHILO/8-364:0.35754):0.34045):0.78197,Q88PE2_PSEPK/4-365:0.07039):0.04471,Q87X21_PSESM/4-365:0.12533,Q9HW29_PSEAE/4-364:0.15322);
ATP  (((((Q87NF1_VIBPA/10-359,Q8D8K7_VIBVU/7-360),Q9KSI9_VIBCH/10-360),((Q92SP9_RHIME/9-359,Q8UIK8_AGRT5/12-362),Q98BK7_RHILO/8-364)),Q88PE2_PSEPK/4-365),Q87X21_PSESM/4-365,Q9HW29_PSEAE/4-364);
ATL  3.81109
DNO  9
DLN  1110
DID  0.498884
DPH  (((((Q8D8K7_VIBVU/7-360:0.20810,Q87NF1_VIBPA/10-359:0.20810):0.08604,Q9KSI9_VIBCH/10-360:0.25442):0.42897,((Q92SP9_RHIME/9-359:0.19406,Q8UIK8_AGRT5/12-362:0.23088):0.19705,Q98BK7_RHILO/8-364:0.27021):0.15641):0.43811,Q9HW29_PSEAE/4-364:0.11598):0.02874,Q88PE2_PSEPK/4-365:0.12224,Q87X21_PSESM/4-365:0.18039);
DTP  (((((Q8D8K7_VIBVU/7-360,Q87NF1_VIBPA/10-359),Q9KSI9_VIBCH/10-360),((Q92SP9_RHIME/9-359,Q8UIK8_AGRT5/12-362),Q98BK7_RHILO/8-364)),Q9HW29_PSEAE/4-364),Q88PE2_PSEPK/4-365,Q87X21_PSESM/4-365);
DTL  3.1197
RID  0.405984
RPH  (((((Q87NF1_VIBPA/10-359:0.16582,Q8D8K7_VIBVU/7-360:0.14804):0.06079,Q9KSI9_VIBCH/10-360:0.30637):0.50547,((Q92SP9_RHIME/9-359:0.16944,Q8UIK8_AGRT5/12-362:0.24318):0.33837,Q98BK7_RHILO/8-364:0.35754):0.34045):0.78197,Q88PE2_PSEPK/4-365:0.07039):0.04471,Q87X21_PSESM/4-365:0.12533,Q9HW29_PSEAE/4-364:0.15322);
RTP  (((((Q87NF1_VIBPA/10-359,Q8D8K7_VIBVU/7-360),Q9KSI9_VIBCH/10-360),((Q92SP9_RHIME/9-359,Q8UIK8_AGRT5/12-362),Q98BK7_RHILO/8-364)),Q88PE2_PSEPK/4-365),Q87X21_PSESM/4-365,Q9HW29_PSEAE/4-364);
RTL  3.81109
LNK  Q87NF1_VIBPA/10-359:Q87NF1:BA000031
LNK  Q87X21_PSESM/4-365:Q87X21:AE016871
LNK  Q88PE2_PSEPK/4-365:Q88PE2:AE016777
LNK  Q8D8K7_VIBVU/7-360:Q8D8K7:AE016807
LNK  Q8UIK8_AGRT5/12-362:Q8UIK8:AE009000
LNK  Q92SP9_RHIME/9-359:Q92SP9:AL591783
LNK  Q98BK7_RHILO/8-364:Q98BK7:BA000012
LNK  Q9HW29_PSEAE/4-364:Q9HW29:AE004853
LNK  Q9KSI9_VIBCH/10-360:Q9KSI9:AE004206
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9HW29_PSEAE/4-364
ASQ  RHVIGLGSLLLGALSFGGWSFSRL-G....SQPLVLSARDDADGQHYAVGYRLDGKCQFATRVAQRCHDIVQHPSLPLALFVARRPGTESYLIDLNDGRLLQTLVSQKDRHFYGHGVFHQSGEWLYATENDTTDPGRGVLGVYRFDGERLQHSGEISTHGLGPHQVSWMPDGETLVVANGGIRTEAE-SRVEMNLDAMEPSLVLMRR-DGNLLSKETLAQ--QMNSVRHLAIGRDGTIVAGQQFMGDAHEHADLLAIKRPGRPFEAFPVAEEQRLAMAQYTASVAIHDDLRLVALTAPRGNRFFIWDLDSGAVRLDAPLPDCAGVGAVKNGFVVTSGQGRCRFYDCQGERIAAQPLELPSGLWDNHLHLA
DSQ  CGTCATGTGATCGGCCTGGGCAGCCTGCTGCTCGGCGCCTTGTCCTTCGGCGGCTGGAGCTTCAGCCGCCTG---GGT............AGCCAACCGCTGGTGCTATCGGCGCGCGACGACGCCGATGGCCAGCATTACGCGGTGGGCTACCGCCTGGACGGCAAGTGCCAGTTCGCCACCCGCGTGGCCCAGCGCTGCCACGACATCGTCCAGCACCCGAGCCTGCCGCTGGCGCTGTTCGTCGCCCGCCGGCCAGGCACCGAAAGCTACCTGATCGACCTGAACGACGGTCGCCTGCTGCAGACCCTGGTCTCGCAGAAAGACCGCCACTTCTACGGCCACGGCGTGTTCCACCAGAGCGGCGAGTGGCTCTACGCCACCGAGAACGACACTACCGATCCCGGTCGCGGCGTGCTCGGCGTCTACCGTTTCGACGGCGAGCGACTGCAGCACAGCGGCGAGATCTCCACCCACGGCCTCGGGCCGCACCAGGTTTCCTGGATGCCCGACGGCGAGACACTGGTAGTGGCCAACGGCGGCATTCGCACCGAGGCGGAA---AGCCGGGTCGAGATGAACCTCGACGCCATGGAGCCCAGCCTGGTGCTGATGCGCCGC---GACGGCAACCTGCTGTCCAAGGAAACCCTGGCGCAG------CAGATGAACAGCGTCCGCCACCTGGCGATCGGTCGCGACGGCACCATCGTCGCCGGCCAGCAGTTCATGGGCGATGCCCACGAACATGCCGACCTGCTGGCGATCAAGCGCCCCGGCCGTCCCTTCGAAGCCTTCCCTGTGGCCGAGGAGCAGCGCCTGGCGATGGCCCAGTACACCGCCAGCGTGGCGATCCACGACGACCTGCGCCTGGTGGCCCTGACCGCCCCGCGCGGCAACCGTTTCTTCATCTGGGACCTGGACAGCGGTGCCGTACGCCTCGACGCGCCGTTGCCGGACTGCGCCGGCGTGGGCGCGGTGAAGAACGGCTTCGTCGTCACGTCCGGACAGGGCCGTTGCCGCTTCTACGACTGCCAGGGCGAGCGCATCGCCGCGCAACCGCTGGAGCTGCCTTCCGGCCTCTGGGACAACCACCTGCACCTGGCC
TRN  11011101101011011
NAM  Q88PE2_PSEPK/4-365
ASQ  RQALKLGSVLLSALTLGGWSLFRSKG....SEPLLLSARDNGDGQHYAVGFRLDGTQVFSTQVAQRCHAIIHHPEQPIALFVARRPGTESYLIDLRDGRLLQTVASQPNRHFYGHAVVHKGGEWLYATENDTTDPGRGVLGVYRFEGERLVHTGEIPTHGIGPHEVAWLPDGETLVVANGGIRTEAE-SRVEMNLDAMQPSLVLMQR-DGTLLSKETLAQ--QMNSVRHLAVASDGTIAACQQFMGDADETAELLAIKRPGEPFKAFPVPERQLQAMAQYTASVAIHSELRLVALTAPRANRLFVWDLDSGAVRLDAPMPDCAGVGAVKDGFVVTSGQGRCRFYDCRKAELVGQPMNLPSGFWDNHLHLV
DSQ  CGCCAGGCACTCAAACTCGGTAGCGTATTGCTCAGTGCCCTCACCTTGGGCGGCTGGAGCCTGTTCCGCAGCAAAGGC............AGCGAACCCTTGCTGCTCTCGGCGCGTGACAACGGCGACGGCCAGCACTATGCCGTAGGTTTTCGCCTGGACGGTACACAGGTGTTCAGCACGCAGGTCGCTCAGCGTTGCCATGCCATCATCCACCACCCCGAGCAGCCAATCGCTCTGTTCGTCGCCCGCCGCCCAGGTACCGAAAGCTACCTGATCGACCTGCGTGACGGGCGCCTGCTGCAAACGGTAGCCTCGCAGCCGAACCGGCACTTCTATGGCCACGCCGTCGTGCACAAAGGCGGCGAATGGCTGTATGCCACCGAGAACGACACCACCGACCCAGGGCGCGGCGTGCTTGGCGTGTACCGTTTCGAAGGCGAACGCCTGGTACACACCGGTGAAATTCCGACCCACGGTATCGGCCCGCACGAGGTTGCCTGGCTGCCTGACGGTGAAACGCTGGTCGTGGCCAACGGCGGTATCCGTACCGAGGCCGAA---AGCCGTGTCGAGATGAACCTCGACGCCATGCAACCGAGCCTGGTGCTGATGCAGCGC---GACGGCACCCTGCTGAGCAAGGAAACCCTGGCCCAG------CAGATGAACAGCGTGCGACACCTGGCAGTGGCCAGCGATGGCACCATCGCCGCCTGCCAGCAGTTCATGGGCGATGCCGATGAAACTGCCGAGCTGCTGGCGATCAAGCGCCCGGGCGAGCCATTCAAGGCCTTCCCGGTACCGGAGCGGCAACTGCAAGCCATGGCCCAATACACCGCAAGCGTTGCCATCCACAGCGAGCTGCGGCTGGTGGCGCTGACGGCACCGCGGGCCAACCGCCTGTTCGTCTGGGACCTGGACAGCGGCGCGGTGCGGCTGGATGCCCCGATGCCCGACTGCGCAGGCGTTGGCGCGGTGAAGGACGGCTTTGTCGTCACCTCCGGGCAGGGCCGCTGCCGGTTCTACGATTGCCGCAAGGCCGAACTGGTCGGGCAACCGATGAACCTGCCGTCCGGCTTCTGGGACAACCACCTGCATCTCGTC
TRN  11011101101011011
NAM  Q87X21_PSESM/4-365
ASQ  RQAMALGSLLLSACTLGGWTLFRQKD....TGPLLLSARDDGEGKHYAVGFRLDGTQVFATQVGQRCHDIINHPSLPLAVFIARRPGTESYLIDLRDGSLLQTIVSQPDRHFYGHAVIHRDGEWLYATENDTRDPGRGLLGVYRFVDERLVHSAEVSTHGIGPHQVSWMPDGETLVVANGGIRTEAE-SRVEMNLNAMQPSLVIMQR-DGTLLSKETLSQ--QMNSVRHMGIASDGTIVASQQFMGDSHEVAELLAIKRPGQPFQAFPVAQEQLRAMGHYTASVAVHSDLRLIALTAPRGNRFFIWDMDSGALKLDAPLPDCAGVGAVVDGFVVTSGQGRCRFYDCRKEELLARPLDLPAGLWDNHLHLV
DSQ  CGCCAAGCGATGGCCCTCGGCAGTCTGTTGCTCAGTGCCTGCACATTGGGTGGATGGACCCTGTTCAGACAGAAAGAC............ACCGGCCCTCTGCTGCTATCTGCGCGCGACGATGGCGAAGGCAAGCACTATGCGGTGGGTTTCCGGCTCGACGGGACGCAGGTGTTTGCCACTCAGGTGGGCCAACGCTGCCATGACATCATCAATCACCCCAGCCTGCCGCTTGCCGTGTTCATCGCACGTCGTCCAGGCACTGAGAGCTATCTGATCGACCTGCGCGACGGTAGCTTGCTACAAACCATTGTTTCGCAGCCGGACAGGCACTTTTACGGCCATGCGGTGATTCATCGTGACGGCGAATGGCTGTATGCAACTGAAAACGACACTCGCGACCCAGGTCGCGGATTGCTGGGCGTTTATCGGTTCGTCGATGAGCGGCTGGTGCACTCGGCAGAGGTATCCACGCACGGCATCGGTCCGCATCAGGTCTCCTGGATGCCGGATGGCGAGACACTCGTCGTTGCCAACGGCGGCATTCGCACCGAAGCGGAA---AGCCGCGTGGAAATGAACCTGAATGCCATGCAGCCCAGCCTGGTGATCATGCAACGC---GATGGCACTCTGCTGAGCAAGGAAACACTCTCGCAA------CAGATGAACAGCGTGCGCCACATGGGCATTGCCAGCGATGGCACCATCGTCGCGAGTCAGCAGTTTATGGGCGATAGCCACGAAGTCGCCGAGTTACTGGCGATCAAACGTCCAGGCCAGCCATTTCAAGCGTTTCCGGTGGCACAGGAGCAATTGCGCGCAATGGGGCACTACACCGCCAGCGTTGCCGTGCACAGCGATCTGCGACTGATCGCACTGACAGCGCCGCGAGGCAACCGGTTCTTCATATGGGATATGGACAGCGGCGCACTGAAACTGGATGCACCGTTGCCGGACTGCGCAGGCGTTGGTGCAGTGGTCGACGGGTTTGTCGTGACGTCAGGTCAGGGGCGCTGCCGCTTCTACGATTGCCGCAAAGAGGAACTGCTGGCCAGGCCGCTGGACCTGCCCGCAGGGTTGTGGGACAACCATCTTCATTTGGTC
TRN  10010101100011000
NAM  Q98BK7_RHILO/8-364
ASQ  RRDFLRAAGIGFAAVMAPSAWAKTLA....ANAVFATAFVKRDGSFGAAILSEAGKVLHAIDLPDRGHDVTFDPISKRSVVFARQPGTFAVVFDHSGRDAPQTVASISGRHFFGHGVFSPDGALLYATEND-FDNAAGVIGIYD-ARAKFSRVGEFPTYGMGPHELLLLGDGRTMAVANGGIETHPDYGRAELNIATMKPSYVLIDRVTGDLIEKHELPASLHQLSIRHMDTDPSGTVWFGCQYRGPGTDRPLLVGRAVRGKELQLLDMPQDVLSGFRNYIGSVAANLSAGSVAVSSPEGNSLVVIDAASGRVVSSSALVEVCGLAPDGSGFIATTGAGEI-------IEGSGATRSEPDYVWDNHMLRI
DSQ  CGTCGCGACTTTCTGAGGGCCGCCGGTATCGGCTTCGCTGCCGTGATGGCGCCGTCTGCCTGGGCGAAGACGCTTGCC............GCCAACGCCGTTTTCGCCACCGCTTTCGTCAAGCGCGACGGCAGTTTTGGTGCCGCCATCCTGTCCGAGGCCGGCAAGGTGCTGCATGCGATCGACCTGCCCGACCGCGGCCATGACGTCACTTTCGATCCCATATCAAAGCGTTCGGTGGTTTTCGCCCGCCAGCCCGGCACCTTCGCCGTCGTTTTCGATCATTCGGGCCGCGACGCACCGCAGACCGTCGCCAGCATCTCCGGCCGGCATTTCTTCGGCCATGGCGTGTTCTCGCCCGATGGCGCGCTGCTCTATGCCACCGAGAACGAT---TTCGACAACGCGGCCGGCGTCATCGGTATCTACGAT---GCGCGGGCGAAATTCAGTCGCGTCGGCGAATTCCCGACCTATGGCATGGGCCCGCACGAGCTCCTGCTCCTGGGCGACGGCCGGACGATGGCGGTCGCCAATGGCGGCATCGAGACCCATCCGGACTATGGCCGCGCCGAGCTCAACATCGCCACCATGAAGCCGTCCTATGTGCTCATCGACCGCGTCACCGGCGACCTCATCGAAAAGCATGAATTGCCGGCTTCCCTGCACCAGCTGTCGATCCGTCACATGGATACCGACCCGTCCGGCACCGTCTGGTTTGGCTGCCAGTACCGGGGGCCGGGCACGGATCGTCCGCTGCTGGTCGGCCGCGCCGTGCGCGGCAAGGAGTTGCAGCTTCTCGACATGCCGCAGGACGTGCTGTCCGGTTTCCGCAACTATATCGGCTCGGTTGCCGCCAATCTTTCAGCCGGCAGCGTCGCCGTCTCGTCGCCGGAAGGCAATTCGCTTGTCGTGATCGATGCGGCCAGCGGCCGGGTGGTCTCGTCCAGCGCGCTGGTCGAGGTGTGCGGCCTGGCGCCGGACGGATCGGGCTTCATCGCCACCACGGGGGCCGGCGAGATC---------------------ATCGAGGGCAGCGGCGCGACGCGGTCTGAGCCGGACTATGTCTGGGACAACCATATGCTGCGCATC
TRN  10010101100011001
NAM  Q8UIK8_AGRT5/12-362
ASQ  RRSFIKAAGIPFLAALAPRSLHALER....TDAVFASAFRARDGSYGIATVSERGEIIDRVALPARAHGMATSHATGRTVAFARRPGTFFMAFDPVQRQEPVVMHAPENRHFYGHGQFSPDGAILYASEND-FDGNRGVIGLYD-ARNGFARIGEYDAHGVGTHDMTVSDDGRLIVIANGGIETHPDFGRTKLNIDSMEPSLVLLDAATGQLIQKHVMPEQLRQLSTRHVDLGDNGRIWFACQYEGPRNNLPPLVGHFSKGEDVAFVDLPEETTVRLANYVGAIAVNRREGLVGLTSPSGNAAVTLDAKTGSVVSEVTVREAAGVATAAGGIAVSSYDGFF-------------EAIRSDVAWDQHIVRL
DSQ  CGGCGCAGCTTCATCAAGGCGGCGGGTATTCCCTTTCTTGCCGCCCTCGCCCCGCGGTCGCTCCATGCGCTGGAACGC............ACAGACGCCGTCTTCGCCTCCGCCTTCCGCGCCCGTGATGGATCCTACGGCATTGCGACGGTAAGCGAGCGCGGCGAAATCATCGACCGCGTTGCGCTTCCCGCCCGCGCCCATGGAATGGCGACGAGCCATGCGACCGGTAGGACCGTGGCCTTCGCGCGCCGTCCCGGCACTTTCTTCATGGCTTTCGATCCCGTGCAACGTCAGGAGCCTGTCGTGATGCACGCGCCGGAGAACCGGCACTTTTATGGCCACGGGCAATTTTCACCCGATGGCGCAATTCTCTATGCCAGCGAAAACGAC---TTCGACGGTAACCGCGGCGTCATCGGCCTTTACGAC---GCCCGCAACGGCTTTGCCCGCATCGGTGAATATGACGCGCATGGTGTCGGCACCCATGACATGACGGTCAGCGATGACGGACGGCTGATCGTGATCGCCAATGGCGGCATCGAGACCCACCCGGATTTCGGCCGAACAAAGCTCAATATCGACAGCATGGAACCGTCACTCGTGCTTCTGGACGCCGCCACCGGCCAGCTGATCCAGAAACATGTAATGCCGGAGCAGCTGCGGCAGCTTTCCACCCGCCACGTCGATCTCGGCGATAACGGCCGCATCTGGTTCGCCTGCCAATATGAAGGACCGCGCAACAATCTTCCGCCGCTTGTCGGCCATTTCTCGAAGGGTGAGGATGTAGCCTTTGTCGATCTGCCGGAGGAAACGACGGTGCGGCTTGCCAATTATGTCGGGGCCATCGCCGTCAACCGGCGCGAAGGGCTGGTGGGTCTGACCTCGCCGAGCGGCAACGCCGCCGTGACGCTCGATGCAAAGACGGGCAGTGTGGTCTCCGAGGTCACCGTGCGGGAGGCGGCGGGCGTTGCGACGGCTGCAGGCGGCATTGCGGTTTCCTCTTATGACGGATTTTTC---------------------------------------GAGGCTATTCGCAGCGACGTGGCCTGGGACCAGCATATCGTACGCCTG
TRN  10010101100011001
NAM  Q92SP9_RHIME/9-359
ASQ  RRSFVKMAGAAWAAALSPRGAFALER....ADAVFASAFMAPDGSYGVATLTEAGEIVERRLLPARAHGMTFSPASRRAVAFARRPGTYAMIFAPDGAAEPVVITSAEGRHFFGHGCFSADGRLLYATEND-FSANRGMVGIYD-GRRGFARIGEFPTYGIGPHDMTLAADGRTLAIANGGIETHPDFGRTKLNLDRMQPSLALVDAATGALIEKHVLPPDLNRLSTRHVDIGADGRVWFACQYEGARNDLPPLVGHFAKGEDLTFVGLPERTTAALANYVGAIAVNRRDGLVGLTSPKGNVAVTLDAKTGAVLREEQVTDAAGVAAAKHGFAVSTYGGRF-------------EKRVSAVAWDQHIVRL
DSQ  CGCCGCAGCTTCGTTAAAATGGCGGGTGCCGCCTGGGCGGCGGCGCTTTCCCCCCGGGGCGCCTTTGCCCTGGAAAGG............GCCGATGCCGTCTTCGCCTCGGCCTTCATGGCGCCGGACGGCAGCTACGGGGTCGCGACGCTCACGGAAGCGGGCGAGATCGTGGAGCGGAGGCTGCTGCCGGCGCGTGCGCACGGCATGACCTTCTCCCCGGCAAGCCGGCGGGCGGTCGCCTTTGCCCGGCGGCCGGGCACCTATGCCATGATCTTTGCGCCGGACGGCGCCGCCGAGCCGGTCGTCATCACCTCCGCCGAGGGCCGCCACTTCTTCGGGCACGGCTGCTTCTCGGCCGACGGCCGTCTGCTCTATGCGACCGAAAACGAC---TTCTCCGCCAATCGCGGCATGGTCGGCATCTATGAC---GGCCGCCGGGGTTTTGCCCGGATCGGCGAATTCCCGACTTACGGTATCGGCCCCCACGACATGACGTTGGCCGCCGACGGACGCACCCTCGCAATCGCCAATGGCGGCATCGAGACCCACCCCGATTTCGGCCGCACCAAGCTCAATCTCGACCGCATGCAGCCGAGCCTCGCCCTCGTAGACGCCGCGACGGGGGCGCTCATCGAGAAGCATGTGCTGCCGCCTGATCTCAACCGCCTTTCGACCCGCCATGTCGACATCGGCGCTGACGGACGTGTCTGGTTCGCCTGCCAATACGAGGGCGCGCGCAACGACCTTCCGCCGCTGGTCGGGCACTTCGCCAAGGGCGAGGACCTGACCTTCGTCGGTCTGCCGGAACGCACCACGGCGGCGCTCGCCAATTATGTCGGTGCCATCGCGGTCAACCGCCGCGACGGACTGGTCGGCCTCACCTCTCCCAAGGGCAACGTCGCCGTCACCCTGGACGCGAAAACGGGCGCCGTCCTCAGGGAGGAACAGGTAACGGACGCAGCAGGCGTTGCCGCGGCGAAGCACGGTTTTGCCGTCTCCACCTATGGCGGCCGGTTC---------------------------------------GAGAAGCGCGTGAGTGCCGTCGCCTGGGACCAGCACATCGTCCGGCTC
TRN  10010101100011011
NAM  Q9KSI9_VIBCH/10-360
ASQ  RRHLLQVALFGCTTPWLISGCSSARS....PQPALIGCAIEGRERFSVVMADNAGQAVGKLALPARGHGIAIHPTLPHAVAFARRPGQFMSVFDYQTAQQIVLRPADTQRHYYGHGVYSHDGRYLYATEGG-QKTSRGVIGVYD-VTHHYQKVAEWSGFGIGPHEVILMADG-RLVVGVGGVHTF---GREPLNLESMQPSLTYLSA-QGEVLEQITLPD--RHLSIRHLAHDGDNTVLCGQQYRGQPDDYPPLVAMHTGTGPLKPLQAEPEQWARFNHYIASIAATDE--WILATSPPGNCYGIWSKATGELVELAALADASGVVVRHGAFQISSGSGKI----ILQSAPELSQSHMSNVMWDNHWSAI
DSQ  CGTCGCCACTTATTGCAAGTGGCGCTTTTTGGCTGCACGACACCTTGGCTAATCAGCGGTTGTAGCTCTGCGCGATCG............CCCCAGCCAGCCTTGATTGGCTGTGCAATAGAAGGGCGAGAACGCTTTAGTGTAGTGATGGCAGATAACGCTGGGCAGGCGGTTGGTAAGCTTGCCTTACCTGCTCGAGGGCATGGTATTGCCATTCACCCAACGTTGCCGCATGCGGTGGCTTTTGCACGCCGCCCCGGTCAGTTTATGTCGGTGTTTGATTATCAAACGGCTCAGCAAATTGTGCTGCGTCCCGCCGATACGCAGCGTCACTACTACGGACATGGTGTCTATTCACATGATGGCCGCTACTTATATGCCACGGAAGGGGGG---CAGAAAACCAGTCGTGGTGTGATTGGCGTTTATGAT---GTGACTCACCACTATCAAAAAGTCGCGGAATGGAGCGGTTTTGGGATTGGTCCTCACGAAGTGATCTTGATGGCCGATGGT---CGTTTGGTTGTGGGGGTTGGTGGCGTCCACACTTTT---------GGCCGTGAGCCGTTAAATCTAGAGAGTATGCAGCCAAGTTTGACTTACCTCTCAGCG---CAAGGTGAGGTACTGGAGCAAATCACTTTACCTGAT------CGCCATCTGAGCATCCGTCATTTGGCTCATGATGGGGATAACACAGTCCTGTGTGGTCAGCAATATCGCGGCCAGCCAGACGATTATCCTCCCTTAGTTGCCATGCACACGGGGACTGGTCCGCTTAAGCCATTACAAGCAGAGCCTGAGCAGTGGGCGCGTTTTAATCACTATATTGCCAGTATTGCGGCGACCGATGAG------TGGATTCTTGCCACCTCTCCCCCCGGGAATTGCTATGGGATCTGGTCAAAAGCCACGGGCGAATTGGTGGAATTAGCCGCTTTAGCCGATGCTTCCGGCGTGGTTGTTCGCCATGGTGCTTTTCAAATCAGTTCGGGGTCGGGCAAAATC------------ATTTTGCAATCTGCACCTGAGCTCTCGCAATCGCATATGAGCAATGTGATGTGGGACAACCATTGGTCAGCGATC
TRN  10010101100011000
NAM  Q87NF1_VIBPA/10-359
ASQ  RRTLLKAALFGAATPVLPFGCAATTK....REPALIGCSIVRRDKFAAVVADEHGMPISTLPIPERGHGVATNQ-HGHAVVFGRRPGTFFMVFDYRTEQMLKLELAKPERHFYGHGVYSHDGLYLFATEGE-RGTSRGIIGVYD-VQNQYRKIAELSGFGIGPHEVIMMPDG-TLAIGVGGVHTN---GREPLNLDSMKPSLSYLSQ-NGELLDQVALPD--HKLSIRHLAHDGSETVLCGQQYRGEPDEYPALLAMHERGGEMQTLQAEPEEWARFNHYIASIAATND--WILATSPPGSCYGIWSKETGKLVELNALPDASGVVIYGDEFRVSSGAGKV----VEQKPSQFKNAYSSGVQWDNHWSRI
DSQ  CGCCGAACGCTTCTAAAAGCGGCACTATTTGGAGCGGCAACTCCCGTGTTGCCGTTTGGTTGTGCGGCGACAACAAAG............CGAGAGCCCGCATTAATTGGCTGTTCCATTGTCAGGCGAGATAAGTTTGCTGCCGTGGTGGCTGATGAACATGGAATGCCTATTTCGACGTTACCTATCCCTGAACGTGGGCATGGCGTGGCGACCAATCAG---CATGGCCACGCGGTTGTTTTTGGTCGACGTCCTGGCACTTTCTTTATGGTGTTCGACTATCGAACAGAACAAATGCTCAAGTTGGAACTGGCAAAACCGGAGCGCCATTTTTACGGCCACGGCGTTTATTCTCACGATGGTCTTTATCTCTTCGCTACGGAAGGCGAA---AGAGGCACTAGCCGAGGCATCATTGGTGTTTACGAT---GTTCAAAACCAATACCGAAAAATCGCTGAGTTATCGGGATTCGGCATTGGGCCTCATGAAGTGATCATGATGCCCGATGGC---ACGTTAGCGATTGGTGTGGGTGGGGTGCATACTAAT---------GGTCGTGAGCCTTTGAATTTGGACAGCATGAAGCCAAGCTTGAGCTACCTTTCGCAA---AACGGAGAGTTGCTTGATCAAGTTGCGTTGCCGGAT------CATAAGTTGAGCATTCGTCACCTTGCGCATGATGGTTCAGAAACGGTGTTGTGCGGCCAGCAATATCGCGGAGAACCTGACGAATATCCTGCTTTGCTCGCCATGCATGAGCGTGGAGGAGAGATGCAAACACTGCAAGCAGAACCTGAAGAATGGGCACGCTTTAATCACTATATAGCCAGTATTGCTGCAACCAATGAT------TGGATTTTAGCAACATCACCTCCGGGCAGTTGTTATGGCATTTGGTCTAAAGAAACGGGCAAGCTGGTGGAGCTGAATGCACTGCCAGATGCGTCTGGTGTGGTGATTTACGGCGATGAGTTTCGCGTCAGTTCTGGAGCGGGAAAAGTT------------GTTGAACAGAAACCTTCGCAATTCAAAAACGCATACTCAAGCGGTGTTCAATGGGACAATCATTGGTCACGAATT
TRN  10010101100011000
NAM  Q8D8K7_VIBVU/7-360
ASQ  RRALLKAALFGVSAPLMPFGCASTNKdarqAEPALVGCAIRGRHQYTAVVADQYGRPLQQLPLPERGHGVATNA-QGHATVFARRPGSFFMVFDYHSGETIHLQSAHPERHFYGHGVYSHAGDYLFATEGE-RSTSRGIIGVYD-VRNRYKKVAELSGFGIGPHEVIMMPDG-VLAIGVGGVHTH---GRAPLNLDTMRPSLSYLSQ-QGKLLEQVALSD--PKLSIRHLAHDGAETVLCGQQYRGEPDEYPSLLAMHTRGGEMMSLRAEPEQWARFNHYIASIAATSD--WILATSPPGNCYGIWSKASGELVELAALPDASGVVVYQDQFRVSSGAGKV----ITTSVQMGSSEIQSNIQWDNHWSKL
DSQ  CGACGAGCTTTATTAAAAGCTGCACTGTTTGGCGTGAGTGCACCGCTCATGCCTTTTGGCTGTGCATCAACCAATAAAgatgcgagacaaGCTGAACCCGCATTGGTGGGATGCGCGATTCGTGGACGTCACCAATATACAGCGGTAGTGGCTGATCAATATGGCCGACCACTACAGCAGTTGCCGCTTCCTGAGCGTGGTCATGGTGTCGCCACCAATGCG---CAAGGACATGCGACGGTATTTGCACGTCGTCCGGGTAGTTTCTTCATGGTGTTTGATTATCACTCAGGAGAAACCATCCATCTGCAAAGTGCGCATCCCGAAAGGCATTTTTATGGCCACGGCGTCTACTCTCATGCCGGGGATTACCTCTTTGCCACCGAGGGAGAG---CGAAGTACAAGCCGAGGTATCATCGGTGTGTACGAT---GTCCGCAACCGTTATAAAAAAGTCGCGGAGCTCAGCGGATTTGGCATTGGCCCTCATGAGGTGATCATGATGCCTGATGGT---GTGTTGGCCATTGGTGTTGGCGGCGTTCATACCCAT---------GGTCGAGCACCATTGAATCTGGACACTATGCGACCATCGTTAAGTTACCTTTCACAA---CAAGGGAAACTGTTAGAGCAAGTCGCTTTATCGGAT------CCTAAGCTAAGCATTCGGCATCTCGCCCACGATGGTGCGGAAACGGTGTTGTGTGGCCAGCAGTATCGAGGTGAGCCGGATGAGTACCCATCGCTGCTGGCGATGCACACTCGTGGGGGGGAGATGATGTCATTACGTGCTGAACCAGAGCAGTGGGCACGTTTTAATCATTACATCGCCAGCATTGCGGCAACATCCGAT------TGGATTTTGGCCACCTCACCACCAGGCAACTGCTATGGTATCTGGTCAAAAGCTAGTGGAGAATTGGTGGAATTAGCTGCATTGCCTGATGCCTCAGGCGTGGTGGTTTACCAAGATCAGTTTCGCGTGAGTTCTGGGGCCGGAAAAGTG------------ATCACCACATCGGTCCAGATGGGCAGTTCTGAGATTCAATCGAATATTCAATGGGATAATCACTGGTCAAAATTA
TRN  10010101100011000
//