EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07404 - TEBP_beta)
FAM  PF07404
PID  TEBP_beta
DES  Telomere-binding protein beta subunit (TEBP beta)
IPR  IPR010874
ANO  3
ALN  387
AID  0.832991
APH  (TEBB_OXYNO/1-372:0.12923,TEBB_STYMY/1-381:0.11907,Q9GNS5_OXYTR/1-375:0.08574);
ATP  (TEBB_OXYNO/1-372,TEBB_STYMY/1-381,Q9GNS5_OXYTR/1-375);
ATL  0.33404
DNO  3
DLN  1161
DID  0.77814
DPH  (TEBB_OXYNO/1-372:0.16615,TEBB_STYMY/1-381:0.13492,Q9GNS5_OXYTR/1-375:0.11570);
DTP  (TEBB_OXYNO/1-372,TEBB_STYMY/1-381,Q9GNS5_OXYTR/1-375);
DTL  0.41677
RID  0.832991
RPH  (TEBB_OXYNO/1-372:0.12923,TEBB_STYMY/1-381:0.11907,Q9GNS5_OXYTR/1-375:0.08574);
RTP  (TEBB_OXYNO/1-372,TEBB_STYMY/1-381,Q9GNS5_OXYTR/1-375);
RTL  0.33404
LNK  Q9GNS5_OXYTR/1-375:Q9GNS5:U63565
LNK  TEBB_OXYNO/1-372:P16458:M31309
LNK  TEBB_STYMY/1-381:P29548:X61748
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TEBB_OXYNO/1-372
ASQ  MSKGASAPQQQSAFKQLYTELFNNEGDFSKVSSNLKKPLKCYVKESYPHFLVTDGYFFVAPYFTKEAVNEFHAKFPNVNIVDLTDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLFRDDEFKTTIQHFRHTALQAAINKTVKGDNLVDISKV--ADAAGKKGKVDAGIVKASASKGDEFSDFSFKEGNTATLKIADIFVQEKGKDALNKAADHTDGA------KVKGGAKGKGKAAAKAA-KGKKLSAKKGDS-SAADVRKSVDKIVKYTPSK-GSRKDTPQKSQ-APAAGKSSAKK---GGKKAVPSAPSPSGKKSALTTDKMTMAQFVKYLDWHEKKKGGKVSSGGKVLGKRSAGKASATSG
DSQ  ATGTCCAAAGGCGCATCTGCACCCCAGCAACAGTCTGCATTCAAGCAACTATACACTGAGCTCTTCAACAACGAGGGCGACTTCTCCAAGGTGTCATCCAACCTCAAGAAGCCCCTCAAGTGCTACGTGAAGGAGTCCTACCCTCACTTCCTCGTGACCGACGGCTACTTCTTTGTTGCCCCCTACTTCACCAAGGAGGCAGTCAACGAGTTCCACGCCAAGTTCCCCAACGTCAACATCGTTGACCTCACCGACAAGGTCATCGTCATCAACAACTGGTCACTCGAACTCAGAAGAGTCAACTCAGCTGAGGTCTTCACCTCCTACGCCAACCTCGAGGCCAGACTCATCGTCCACTCATTCAAGCCCAACCTCCAGGAGAGACTCAACCCCACTCGCTACCCCGTCAACCTCTTCAGAGACGACGAGTTCAAGACCACCATCCAGCACTTCAGACACACCGCTCTCCAGGCTGCTATCAACAAGACCGTCAAGGGAGACAACTTGGTCGACATCTCCAAGGTC------GCTGATGCCGCAGGAAAGAAGGGCAAGGTCGACGCTGGAATCGTCAAGGCCTCCGCCTCCAAGGGAGACGAGTTCTCCGACTTCTCCTTCAAGGAGGGCAACACCGCCACTCTCAAGATCGCAGACATCTTCGTCCAGGAGAAGGGCAAGGATGCTCTCAACAAGGCTGCTGACCACACCGATGGCGCC------------------AAGGTCAAGGGTGGAGCCAAGGGCAAGGGTAAGGCTGCTGCCAAGGCCGCC---AAAGGAAAGAAGCTCTCCGCCAAGAAGGGCGACTCC---TCCGCCGCTGACGTGAGAAAGAGCGTCGACAAGATCGTTAAGTACACTCCCAGCAAG---GGCTCCCGCAAGGACACCCCTCAGAAGAGCCAG---GCCCCAGCTGCCGGCAAGTCTTCCGCCAAGAAG---------GGAGGCAAGAAGGCAGTTCCCTCTGCTCCTTCCCCAAGCGGCAAGAAGTCTGCCCTCACCACCGACAAGATGACTATGGCTCAGTTCGTGAAGTACCTCGACTGGCACGAGAAGAAGAAGGGAGGCAAGGTCTCCTCAGGCGGCAAGGTCCTCGGAAAGAGATCTGCTGGCAAGGCCTCCGCCACCTCAGGC
TRN  10010101110011001
NAM  TEBB_STYMY/1-381
ASQ  MSKGQ-A-QQQSAFKQLFTEFFNLGGDFSKVSKDLKKPLKTYVKESYPHFLVTDGYFFVQPHFTKEAVAEFHQKFPNVNIVDLHDKVIVINSWSLELRRVNSAEVFTSYANLEARLVVHSFKPNLQERLNPTRYPVNLFRDDEFKTIIQHFRHQALQQSIAKNTKQESLPDISKLSGADAAGKKTKVDGGIVKTGASKGDEFADFSFKEGSTAVLKIQDIFVQEKGKDALKRIQD-QQVESVQVQPKVRGGAKGKKKAATKSA--TKKTVAAKK-TAESADVRKSVDKIVKYTPNKPSSRKETPQKSQSAPAAGKSSAKRTTTGSKTKIPANPSPSGKKSTKTTDQMTMAQFKKYLDWHEKKKGGKTSSGGKVLGKRSAGKASATSG
DSQ  ATGAGCAAAGGTCAA---GCC---CAACAACAAAGCGCATTCAAACAACTCTTCACTGAGTTCTTCAACCTCGGCGGCGACTTCAGCAAGGTGTCCAAGGACTTGAAGAAGCCCCTGAAGACCTACGTCAAGGAATCTTACCCCCACTTCCTCGTTACCGATGGATACTTCTTCGTCCAGCCCCACTTCACCAAGGAGGCCGTCGCTGAGTTCCACCAGAAGTTCCCCAACGTGAACATCGTCGACTTACACGATAAGGTTATTGTCATCAACAGCTGGTCGCTCGAGCTCAGAAGAGTCAACTCGGCCGAGGTCTTCACTTCTTATGCTAACCTTGAAGCCAGATTGGTTGTCCACTCCTTCAAGCCAAACCTCCAGGAGAGACTGAACCCCACCAGATACCCCGTCAATCTCTTCAGAGACGACGAATTCAAGACCATCATCCAGCACTTCCGCCACCAGGCCCTCCAGTAATCCATTGCCAAGAACACTAAATAAGAGTCGCTTCCAGATATCTCAAAGCTCTCAGGCGCTGACGCCGCCGGCAAGAAGACCAAGGTCGACGGAGGTATTGTTAAAACCGGCGCCTCCAAGGGAGACGAGTTCGCTGACTTCTCGTTCAAGGAGGGCAGCACCGCCGTGCTCAAGATCCAGGACATCTTCGTCCAGGAGAAGGGCAAAGACGCTCTCAAGAGAATTCAAGAT---CAACAAGTGGAGAGCGTGCAAGTTCAGCCAAAGGTCAGGGGAGGCGCCAAGGGCAAGAAGAAGGCCGCCACCAAGTCAGCC------ACCAAGAAGACCGTCGCTGCCAAGAAG---ACTGCCGAGTCCGCCGACGTGAGAAAGAGCGTCGACAAGATCGTCAAGTACACCCCCAACAAGCCATCAAGCAGAAAGGAAACCCCATAAAAGAGCCAGTCCGCTCCAGCTGCTGGCAAGTCATCTGCCAAGAGAACCACCACCGGCTCAAAGACCAAGATCCCAGCCAACCCCTCCCCAAGCGGAAAGAAGTCAACCAAGACTACCGATCAAATGACTATGGCTCAGTTCAAGAAATACCTCGACTGGCACGAAAAGAAGAAGGGTGGCAAGACCTCTTCAGGTGGTAAAGTTCTTGGAAAGAGAAGCGCTGGAAAGGCCTCCGCTACCTCAGGC
TRN  00000100000000000
NAM  Q9GNS5_OXYTR/1-375
ASQ  MSKSQQV-QQQSAFKQLYTELFNNGGDFGKVSNNLKKPLKCYVKESYPHFLVTDGYFFVTPYFTKEAVTEFHSKFPNVNIVDLHDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLYRDDEFKTTIQHFRHQALQQSLAKNLKQENIPDIAKVTGGD---KKAKVDAGIVRASTSKGDEFSDFSFKEGNTATIRIQDIFVQEKGKDALSKLGGEGDV-------KVKGGARGKAKAASKSAARGKKGSAKKADVGASADVRKSVDKIVKYTPNKPSSRKETPQKSQSVPA-GKSSAKKTTTGSKKTLPANPSPSGKKSTKTTDQMTMAQFKRYLEWHEKKNVGKTSSGGKVLGKRSAGKASATSG
DSQ  ATGAGCAAATCACAACAAGTT---CAACAACAAAGCGCCTTCAAGCAACTCTACACCGAGCTATTCAACAACGGTGGTGACTTCGGCAAGGTCTCAAACAACTTAAAGAAGCCATTGAAGTGCTACGTCAAAGAATCATACCCACATTTCCTTGTTACCGATGGTTATTTCTTCGTGACCCCATACTTCACCAAGGAGGCCGTGACTGAATTCCACTCTAAGTTCCCCAACGTAAACATCGTCGACCTCCACGACAAGGTTATCGTTATCAACAACTGGTCACTCGAGCTCAGAAGAGTCAACTCAGCTGAGGTTTTCACTTCTTATGCCAACCTTGAGGCCAGACTCATCGTCCACTCATTCAAGCCAAACCTCCAAGAGAGACTCAACCCCACCAGATACCCAGTCAACTTGTACAGAGACGACGAATTCAAGACCACCATCCAACACTTCAGACATCAAGCTCTCCAACAATCACTCGCCAAGAACCTCAAGCAAGAGAACATTCCAGATATTGCCAAGGTCACTGGTGGTGAC---------AAGAAGGCCAAGGTTGATGCCGGTATTGTCAGAGCCAGCACCTCCAAGGGTGACGAGTTCTCCGACTTCTCATTCAAAGAAGGCAACACTGCTACCATCAGAATCCAAGACATTTTCGTCCAAGAAAAGGGCAAAGATGCTCTCAGCAAGTTAGGCGGAGAAGGAGACGTG---------------------AAGGTCAAGGGTGGTGCCAGAGGTAAAGCAAAGGCTGCCTCTAAATCAGCTGCCAGAGGAAAGAAGGGTTCAGCCAAGAAGGCCGACGTTGGTGCTTCAGCCGATGTCAGAAAGAGCGTTGACAAGATCGTTAAGTACACTCCCAACAAGCCATCAAGCAGAAAGGAGACCCCACAAAAGAGTCAATCAGTCCCAGCT---GGTAAATCATCTGCCAAGAAGACTACCACTGGTTCAAAGAAGACCCTTCCAGCCAACCCATCCCCAAGTGGAAAGAAGTCAACCAAGACCACCGATCAAATGACCATGGCCCAATTCAAGAGATACCTCGAATGGCACGAGAAGAAGAATGTTGGCAAGACCTCATCAGGCGGCAAAGTCCTCGGAAAGAGATCCGCTGGTAAGGCTTCAGCAACCTCCGGT
TRN  10010101110011000
//