EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07395 - Mig-14)
FAM  PF07395
PID  Mig-14
DES  Mig-14
IPR  IPR009977
ANO  5
ALN  275
AID  0.430744
APH  (((Q87VE7_PSESM/35-298:0.18831,Q9HUG2_PSEAE/35-298:0.20315):0.05977,Q88D85_PSEPK/35-298:0.09211):1.26414,Q8Z4G7_SALTI/35-298:0.25856,Q9F148_ECOLI/2-225:0.44537);
ATP  (((Q87VE7_PSESM/35-298,Q9HUG2_PSEAE/35-298),Q88D85_PSEPK/35-298),Q8Z4G7_SALTI/35-298,Q9F148_ECOLI/2-225);
ATL  2.51207
DNO  5
DLN  825
DID  0.51231
DPH  (Q9HUG2_PSEAE/35-298:0.20720,((Q8Z4G7_SALTI/35-298:0.22014,Q9F148_ECOLI/2-225:0.38215):0.85396,Q88D85_PSEPK/35-298:0.06945):0.08579,Q87VE7_PSESM/35-298:0.15600);
DTP  (Q9HUG2_PSEAE/35-298,((Q8Z4G7_SALTI/35-298,Q9F148_ECOLI/2-225),Q88D85_PSEPK/35-298),Q87VE7_PSESM/35-298);
DTL  1.97469
RID  0.430744
RPH  (((Q87VE7_PSESM/35-298:0.18831,Q9HUG2_PSEAE/35-298:0.20315):0.05977,Q88D85_PSEPK/35-298:0.09211):1.26414,Q8Z4G7_SALTI/35-298:0.25856,Q9F148_ECOLI/2-225:0.44537);
RTP  (((Q87VE7_PSESM/35-298,Q9HUG2_PSEAE/35-298),Q88D85_PSEPK/35-298),Q8Z4G7_SALTI/35-298,Q9F148_ECOLI/2-225);
RTL  2.51207
LNK  Q87VE7_PSESM/35-298:Q87VE7:AE016874
LNK  Q88D85_PSEPK/35-298:Q88D85:AE016792
LNK  Q8Z4G7_SALTI/35-298:Q8Z4G7:AL627276
LNK  Q9F148_ECOLI/2-225:Q9F148:AF155222
LNK  Q9HUG2_PSEAE/35-298:Q9HUG2:AE004913
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9HUG2_PSEAE/35-298
ASQ  HPLVVEQLAEMAGIPVRYLGWESAGELVAAIPTWGRHLALSKDVLKRRGKKGLYDLGNAELILPVAGDARIALRHAGRYLSALHERNIVTLR---PQTEQLAFARAPEDFSKKFRYNQRREVRLVEEAGGQVRQADSFAPAEFAAIYLELFQRRWG--FPATGAERMAEVFERLRELLRGSVLLLNDQPIAVQVLYRAEAPGWLSVEYINGGV--DPQTREFSPGSVLSYLNTQAAWEDARALGKPLRYSFG--RADREYKDRWCHPSPVFQ--V
DSQ  CACCCGCTGGTGGTCGAGCAGCTCGCCGAAATGGCTGGAATCCCGGTGCGTTACCTGGGTTGGGAGAGCGCTGGCGAACTGGTTGCGGCGATCCCGACCTGGGGCCGCCACCTGGCGTTGTCCAAGGACGTGCTCAAGCGGCGCGGCAAGAAGGGCCTGTACGACCTGGGCAACGCCGAACTGATCCTGCCGGTGGCCGGCGATGCCCGCATCGCCCTCCGCCATGCGGGACGCTACCTGTCGGCGCTGCATGAGCGGAACATCGTCACGCTGCGC---------CCTCAGACCGAGCAACTGGCTTTCGCTCGTGCTCCCGAGGATTTCTCCAAGAAGTTCCGCTATAACCAGCGGCGCGAAGTGCGCCTGGTGGAGGAGGCCGGTGGCCAGGTGCGCCAGGCAGACAGCTTCGCCCCGGCCGAGTTCGCTGCCATCTATCTTGAACTGTTCCAGCGTCGCTGGGGT------TTCCCTGCCACCGGCGCGGAGCGCATGGCCGAGGTCTTCGAGCGGCTGCGCGAATTGCTGCGCGGCTCGGTCCTGCTGCTCAACGACCAGCCCATCGCGGTCCAGGTACTGTATCGCGCCGAAGCGCCGGGCTGGCTCAGCGTCGAGTACATCAACGGCGGCGTC------GATCCGCAGACCCGCGAGTTCAGCCCTGGCAGCGTGCTCAGTTACCTGAACACCCAGGCCGCCTGGGAGGATGCGCGAGCGCTGGGCAAACCCCTGCGCTATTCGTTCGGT------CGCGCCGACCGCGAATACAAGGATCGCTGGTGCCATCCTTCTCCGGTCTTCCAG------GTC
TRN  11011101101011011
NAM  Q88D85_PSEPK/35-298
ASQ  HPLVVEQLADLAQIPVRYLGWHQAGELQAAIPAWGRHLALSKDVLKRAGKKALFDLGNAEIILPAASDAAAPLRHTMRYLSELNQGRFSGLK---AQKEQLAMARAPEDLSKKFRYNQRRELRLLEEAGGVVRPISDFSAQEIASMYCDLFLRRWG--FPATGAERMADVLERLRELLIGSVLLLDGKPIAIQLVYRVEAPEWISVEYINGGV--DPETKAFSPGSVLSFLNTQAAWEDARSRNKPLRFSFG--RADREYKDRWCNPVPVYQ--A
DSQ  CATCCGCTGGTGGTCGAGCAACTGGCGGACCTGGCACAGATCCCGGTGCGTTACCTGGGCTGGCACCAGGCTGGCGAGCTGCAAGCCGCCATCCCGGCCTGGGGGCGTCACCTGGCGCTGTCCAAGGACGTGCTGAAGCGTGCTGGCAAGAAGGCCCTGTTCGACCTCGGTAATGCCGAGATCATTCTGCCGGCGGCGTCTGATGCCGCTGCGCCGTTGCGCCATACAATGCGTTACCTGTCCGAACTGAACCAGGGCCGCTTCAGCGGTCTCAAG---------GCGCAGAAGGAGCAGTTGGCCATGGCCCGGGCGCCTGAAGACCTGTCGAAGAAGTTCCGCTACAACCAGCGCCGTGAACTGCGCCTGCTGGAAGAGGCGGGTGGTGTGGTACGCCCGATCAGCGACTTCAGTGCCCAGGAAATCGCCAGCATGTATTGCGACCTGTTCCTGCGCCGCTGGGGG------TTCCCGGCCACCGGTGCCGAGCGTATGGCCGATGTGTTGGAGCGCCTGCGTGAGCTGCTGATCGGCTCGGTGTTGCTGCTGGACGGTAAGCCGATTGCCATCCAGCTGGTGTACCGCGTCGAAGCGCCGGAGTGGATCAGCGTCGAGTACATCAATGGCGGCGTC------GACCCTGAAACCAAGGCCTTCAGCCCAGGCAGCGTGCTGAGCTTCCTCAATACCCAGGCCGCCTGGGAAGACGCCCGGTCACGCAACAAGCCGCTGCGGTTCTCGTTCGGC------CGTGCTGACCGTGAGTATAAGGACCGCTGGTGCAACCCTGTGCCGGTGTATCAA------GCG
TRN  11011111101111101
NAM  Q87VE7_PSESM/35-298
ASQ  HPLVVARLSEFSGIPVRYLAWEQGGEVKAAIATWGRSLALSKDELKRHGKKGLFDLGNAELILPVAEGVQVPVRHRARYVSALNEGRISTLK---SQTESLAMARTPEELSKKFRYNQRRELRLLEEAGGTVRPVSEFSSAELASMYCDLFQRRWG--FEATGARDKAQVIELLRDLLIGSVVFLNDAPIAIQLVYRVEAPQWVSIEYVNGGV--DPETRDFSPGSVLSFVNTQSAWEDARALGKALRFSFG--RADREYKDRWCNPVPVFQ--L
DSQ  CACCCGCTGGTGGTTGCACGTTTGTCGGAGTTTTCCGGCATCCCGGTGCGCTATCTGGCCTGGGAGCAGGGCGGTGAAGTCAAGGCGGCGATCGCCACCTGGGGGCGCTCGCTGGCGCTGTCCAAGGACGAACTCAAGCGCCACGGCAAGAAAGGCCTGTTCGATCTGGGTAATGCCGAGCTGATTCTGCCGGTGGCCGAAGGGGTGCAGGTGCCGGTTCGCCATCGGGCTCGTTACGTGTCGGCGCTCAACGAAGGCCGGATCAGCACGCTCAAG---------TCGCAGACCGAATCACTGGCAATGGCGCGCACGCCTGAAGAGCTGTCGAAGAAGTTTCGTTACAACCAGCGCCGCGAACTTCGCTTGCTGGAAGAGGCGGGCGGTACGGTGCGGCCGGTCAGCGAGTTCAGCAGCGCCGAACTGGCGAGCATGTATTGCGACCTGTTTCAGCGCCGCTGGGGC------TTTGAAGCCACCGGTGCCCGGGACAAGGCCCAGGTCATCGAGTTGCTGCGCGACCTGTTGATCGGCTCGGTGGTGTTTCTCAACGACGCGCCCATCGCCATTCAACTGGTGTACCGCGTCGAAGCGCCGCAGTGGGTCAGCATCGAGTACGTCAACGGTGGCGTC------GACCCCGAAACCCGTGATTTCAGTCCGGGCAGCGTGCTGAGCTTCGTCAACACCCAGTCCGCCTGGGAAGACGCCAGGGCGCTGGGCAAGGCACTGCGGTTTTCCTTCGGT------CGTGCCGACCGCGAGTACAAGGACCGTTGGTGCAACCCCGTTCCGGTATTCCAG------CTT
TRN  10010101100011001
NAM  Q9F148_ECOLI/2-225
ASQ  HPDVVSFFMKNHAWKIDFFHYEKNGDIKGA-------YFLCNGTQVGIMARRRYPLSSDEILIPFDSHTKWFFPDKTNKLSMINKPNIINATWSIARKKQNCIIK--EDFSRNFENRRRNEVQRFIRNGGEIKCIEELSDSEIARLYISLFKSRFGNMLPCYKYDDLLRFVSYLRKMIFGYVLFWNNKPCAIDIVLKSESSCNVYYDVPNGAILNDDGCMKVSPGSVPYVVK------------------------------------------Y
DSQ  CACCCGGATGTTGTTTCATTTTTTATGAAGAATCATGCATGGAAGATTGATTTTTTTCACTATGAAAAAAATGGTGATATTAAAGGCGCA---------------------TACTTCCTGTGCAATGGAACGCAAGTTGGCATAATGGCTCGAAGGCGTTATCCTTTGTCATCTGATGAGATTTTAATTCCTTTTGATTCTCATACGAAATGGTTTTTTCCGGACAAAACGAATAAATTATCCATGATAAATAAACCTAACATAATAAACGCAACATGGAGTATAGCCAGAAAAAAGCAAAACTGCATAATAAAA------GAAGATTTTTCCCGGAATTTTGAAAACAGACGACGAAATGAAGTCCAGAGATTTATCAGAAACGGTGGAGAGATTAAATGCATAGAGGAGTTATCAGATAGTGAAATAGCCAGATTATACATATCACTTTTCAAGTCTCGATTTGGAAATATGTTACCTTGCTATAAATATGATGATTTATTGAGATTTGTTTCTTATCTGCGGAAAATGATATTTGGGTACGTGCTATTTTGGAATAATAAGCCTTGTGCTATTGACATTGTTTTGAAATCTGAAAGTTCATGTAATGTTTATTATGATGTCCCAAATGGTGCGATACTGAATGATGATGGCTGTATGAAGGTCAGTCCTGGAAGTGTCCCTTATGTGGTCAAA------------------------------------------------------------------------------------------------------------------------------TAT
TRN  10010101100011000
NAM  Q8Z4G7_SALTI/35-298
ASQ  HPDIVDYFMKRHNWHFKFFHYKEDDKIKGA-------YFICNDQNIGILTRRTFPLSSDEILIPMAPDLRCFLPDRTNRLSALHQPQIRNAIWKLARKKQNCLVK--ETFSSKFEKTRRNEYQRFLKKGGSVKSVADCSSDELTHIFIELFRSRFGNTSSCYPADNLANFFSQLHHLLFGHILYIEGIPCAFDIVLKSESQMNVYFDVSNGAI--KNECRPLSPGSILMWLNISRARHYCQERQKKLLFSIGILKPEWEYKRMWSTPYFTGKSIC
DSQ  CACCCAGATATTGTGGATTATTTTATGAAGCGCCATAACTGGCATTTTAAATTCTTCCACTATAAAGAAGATGATAAGATTAAAGGCGCC---------------------TACTTTATCTGTAATGATCAGAATATTGGCATCCTGACGCGCAGAACCTTCCCGCTATCTTCAGATGAGATACTTATTCCGATGGCGCCAGATTTACGCTGCTTCTTGCCCGATCGTACTAACCGACTTTCGGCGTTGCATCAGCCACAAATACGCAATGCCATATGGAAACTCGCCAGAAAGAAACAAAATTGTCTGGTCAAA------GAAACGTTCTCTTCTAAGTTTGAAAAAACACGCCGTAATGAATATCAGCGGTTTCTTAAAAAAGGCGGAAGTGTAAAAAGCGTTGCTGATTGTTCTTCTGATGAACTGACTCATATTTTTATCGAGTTATTTCGGTCTCGTTTCGGCAATACTTCATCCTGCTATCCCGCTGATAACCTTGCCAACTTTTTTAGTCAACTGCATCACCTTCTGTTTGGGCATATTCTTTATATTGAAGGGATACCCTGTGCATTTGATATCGTACTGAAATCTGAAAGCCAGATGAACGTCTACTTTGACGTATCTAATGGTGCAATT------AAAAATGAATGCAGGCCACTCAGTCCCGGCAGCATACTAATGTGGCTAAATATTAGCCGTGCCAGACATTACTGCCAGGAAAGACAAAAAAAATTGCTTTTCTCCATCGGCATACTAAAGCCTGAATGGGAATATAAGCGCATGTGGTCGACCCCCTATTTTACCGGGAAATCGATTTGC
TRN  10010101100011000
//