EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07354 - Sp38)
FAM  PF07354
PID  Sp38
DES  Zona-pellucida-binding protein (Sp38)
IPR  IPR010857
ANO  5
ALN  275
AID  0.456058
APH  ((ZPBP2_CHICK/79-352:0.42174,(ZPBP2_RAT/55-326:0.15691,ZPBP2_HUMAN/56-327:0.11598):0.25557):0.84121,ZPBP1_PIG/86-350:0.23922,ZPBP1_CHICK/58-320:0.27992);
ATP  ((ZPBP2_CHICK/79-352,(ZPBP2_RAT/55-326,ZPBP2_HUMAN/56-327)),ZPBP1_PIG/86-350,ZPBP1_CHICK/58-320);
ATL  2.31053
DNO  5
DLN  825
DID  0.539557
DPH  ((ZPBP2_CHICK/79-352:0.32270,(ZPBP2_RAT/55-326:0.11498,ZPBP2_HUMAN/56-327:0.11906):0.20072):0.59359,ZPBP1_PIG/86-350:0.20063,ZPBP1_CHICK/58-320:0.24391);
DTP  ((ZPBP2_CHICK/79-352,(ZPBP2_RAT/55-326,ZPBP2_HUMAN/56-327)),ZPBP1_PIG/86-350,ZPBP1_CHICK/58-320);
DTL  1.79559
RID  0.456058
RPH  ((ZPBP2_CHICK/79-352:0.42174,(ZPBP2_RAT/55-326:0.15691,ZPBP2_HUMAN/56-327:0.11598):0.25557):0.84121,ZPBP1_PIG/86-350:0.23922,ZPBP1_CHICK/58-320:0.27992);
RTP  ((ZPBP2_CHICK/79-352,(ZPBP2_RAT/55-326,ZPBP2_HUMAN/56-327)),ZPBP1_PIG/86-350,ZPBP1_CHICK/58-320);
RTL  2.31053
LNK  ZPBP1_CHICK/58-320:Q6Q2W4:AY563140
LNK  ZPBP1_PIG/86-350:Q29108:D17572
LNK  ZPBP2_CHICK/79-352:Q6PVW7:AY575015
LNK  ZPBP2_HUMAN/56-327:Q6X784:AY251603
LNK  ZPBP2_RAT/55-326:Q6X782:AY251605
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ZPBP1_CHICK/58-320
ASQ  VTNRLRNSELIDPVFRWNGPSGYLSSANSSVQISPTGTLILGHFRSDLSGVYTCSLVYKLIAAQPD----KRLTIKYHIYAYSDPQYYYELTVQYHAAPCNSFHNTSFGRALLQILSKLVADLSCEVSLIKSECHHVKMQRGGLQSEMFFKFSVTCLDTENNKLCRQ-SA-CDKPHR--LHKAKDLIERFFKREVEIRKKSTEP-LPEIYYIEGTLQMVWVDRCYPGYGINAVRHPDCPECCVICSPRSYNPSNGIHCLQCDTSLI--YGATTC-
DSQ  GTTACAAATCGTCTGCGAAACTCAGAATTGATTGATCCAGTATTCCGGTGGAATGGACCAAGTGGTTATCTTTCTTCAGCAAATAGCAGTGTGCAAATATCACCAACGGGAACTTTAATATTGGGACACTTCAGATCTGACCTGAGTGGAGTTTACACTTGTTCTCTTGTTTATAAGCTTATCGCTGCACAACCAGAT------------AAAAGACTCACAATAAAATACCATATTTATGCTTATTCTGATCCTCAGTATTACTATGAATTGACAGTCCAGTACCATGCAGCCCCCTGCAATAGTTTTCACAATACTTCTTTTGGGAGGGCATTGCTTCAGATACTAAGCAAGCTTGTTGCTGACCTTTCATGTGAGGTTTCATTAATTAAGTCAGAATGCCACCATGTAAAAATGCAGAGAGGAGGCCTCCAGAGCGAAATGTTCTTTAAATTTTCAGTTACTTGCTTAGACACAGAAAACAACAAACTATGTCGGCAA---AGTGCT---TGTGATAAACCTCATAGA------TTACACAAGGCAAAGGACCTCATAGAGAGATTTTTTAAGCGAGAGGTGGAAATTAGGAAGAAAAGTACTGAACCA---TTGCCTGAAATATACTACATTGAAGGTACTCTGCAAATGGTGTGGGTTGATCGTTGCTATCCAGGATATGGAATTAATGCTGTAAGGCATCCAGACTGCCCAGAGTGTTGTGTTATCTGCAGCCCAAGATCTTACAATCCTAGTAACGGAATTCACTGTCTTCAGTGTGACACCAGTTTGATA------TACGGAGCAACGACATGC---
TRN  10010101100011000
NAM  ZPBP1_PIG/86-350
ASQ  VTQRLRNFELVDPSFQWHGPKGKIVSENSTAQVTSTGSLVFQNFEESMSGVYTCFLEYKP----TVEEVVKNLQLKYIIYAYREPRYYYQFTARYHAAPCNSIYNISFEKKLLQILSKLVLDLSCEVSLLKSECHRVKMQRAGLQNELFFTFSVSSLDTEKGPKPCA-GHSCESSKR--LSKAKNLIERFFNQQVEVLGRRAEP-LPEIYYIEGTLQMVWINRCFPGYGMNILKHPKCPECCVICSPGTYNSRDGIHCLQCNSSLV--FGAKACL
DSQ  GTAACCCAGCGGCTGCGGAATTTTGAACTGGTAGACCCATCATTCCAGTGGCATGGGCCAAAAGGAAAAATCGTTTCAGAAAACAGCACTGCGCAGGTAACCTCCACGGGAAGCCTTGTGTTCCAGAACTTCGAGGAGAGCATGAGTGGCGTTTACACCTGCTTCCTGGAATATAAACCT------------ACTGTGGAAGAAGTCGTTAAAAACCTTCAACTGAAATATATTATATATGCTTATCGTGAGCCCCGCTATTATTACCAGTTCACCGCTCGATACCACGCGGCTCCCTGCAATAGCATCTACAATATTTCTTTTGAGAAGAAACTTCTTCAGATTTTAAGCAAGTTAGTTCTTGACCTTTCGTGTGAAGTTTCCCTGCTCAAGTCCGAATGCCATCGTGTTAAAATGCAAAGAGCTGGTTTGCAAAATGAATTGTTCTTTACATTTTCAGTTTCATCTCTAGACACTGAAAAAGGACCCAAGCCATGTGCA---GGCCATAGTTGCGAATCTTCCAAAAGG------CTGTCGAAGGCTAAAAACCTCATAGAAAGATTTTTTAATCAACAAGTAGAAGTTCTGGGCAGGCGTGCAGAGCCA---TTGCCAGAAATATACTATATCGAAGGTACTCTCCAGATGGTCTGGATTAACCGCTGCTTTCCAGGGTATGGAATGAACATCCTGAAACATCCGAAGTGTCCTGAGTGCTGCGTCATCTGCAGCCCTGGAACTTATAACTCCCGTGACGGAATTCACTGCCTTCAGTGCAATAGCAGCCTGGTG------TTTGGAGCAAAAGCATGCTTA
TRN  10010101100011000
NAM  ZPBP2_CHICK/79-352
ASQ  MDLSLSQEEIIDPKYSWTGPDGRNLEGRGYANLTGSGELMLVGFQESMSGAYTCTLSHRIIETSAQEEVDVRDTYRFMVYAYREANHVYQVSVRFTAKGCELAANARFVEELKKIMESLISDLTCGVKGPSYRCHSLEAPHRGSPSELFITFQVNPFAPGWEDLCSRLPQDCEDTTNRRAQEATERIGEFFRKQTYALKHQFQT-VPTIHYVEGSFSVTPIDSCRPGFGRNNITHRSCAGCCVVCSPGTYSPDSAGSCRVCAGRRTAGYGAKSCP
DSQ  ATGGATTTGTCTCTCTCTCAAGAAGAAATAATAGACCCCAAGTATTCGTGGACTGGCCCAGACGGGAGGAATTTAGAAGGGCGAGGATACGCAAATCTCACGGGCTCTGGGGAGCTGATGCTGGTGGGCTTCCAGGAGTCCATGTCCGGAGCCTACACGTGTACGCTTTCCCACAGAATCATAGAAACCTCAGCACAAGAAGAAGTAGATGTGAGAGATACGTACAGGTTCATGGTGTATGCATACAGGGAAGCCAACCACGTGTATCAGGTCTCGGTCCGCTTCACCGCGAAGGGATGCGAGCTGGCGGCCAACGCGCGGTTCGTGGAGGAGCTGAAGAAGATCATGGAGAGCCTCATCTCCGACCTGACGTGCGGCGTGAAGGGGCCGTCGTACCGCTGCCATTCCCTCGAGGCTCCGCACCGGGGCTCCCCGAGCGAACTGTTCATCACTTTTCAGGTGAACCCCTTTGCTCCGGGATGGGAGGATCTCTGCAGCCGCCTCCCTCAGGACTGTGAGGACACCACGAACCGGAGAGCTCAGGAGGCAACAGAGCGAATAGGAGAGTTCTTCAGGAAGCAGACCTACGCTCTGAAGCACCAATTTCAGACC---GTTCCTACCATACATTACGTGGAGGGCAGCTTCTCCGTGACCCCCATCGACAGCTGCCGCCCGGGGTTTGGGAGGAACAACATCACCCACCGGAGCTGCGCCGGCTGCTGTGTGGTGTGCAGCCCTGGGACGTACAGCCCTGATAGCGCTGGCAGCTGCCGGGTGTGTGCGGGGCGCCGCACTGCGGGGTACGGAGCGAAGTCCTGCCCG
TRN  10010101100011000
NAM  ZPBP2_HUMAN/56-327
ASQ  MDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNG-SVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLT--YGAKSCP
DSQ  ATGGATTTTAAGCTTTCTAAAAAAGAAATAGTGGACCCCACCTACTTATGGATTGGGCCTAATGAAAAGACGTTAACAGGAAATAATAGAATAAATATAACTGAAACTGGACAGCTGATGGTGAAAGATTTTTTGGAGCCTTTGTCTGGACTTTACACATGTACTCTTTCTTATAAGACTGTTAAAGCAGAAACTCAAGAAGAAAAAACAGTCAAAAAGAGATATGACTTTATGGTCTTTGCCTATCGGGAACCTGATTATTCATATCAGATGGCTGTACGTTTTACCACAAGGTCTTGTATAGGGAGATACAATGATGTATTCTTTAGAGTGCTGAAGAAAATCTTGGATAGTCTAATTTCTGATTTGTCATGCCATGTCATAGAGCCATCATATAAATGCCATTCTGTTGAAATTCCAGAACATGGCCTCATACATGAGCTATTTATAGCATTTCAAGTTAATCCTTTTGCGCCGGGGTGGAAAGGTGCTTGCAATGGA---TCTGTTGACTGTGAAGATACCACTAATCATAATATCCTCCAGGCAAGAGATCGAATAGAAGACTTTTTTCGGAGCCAAGCATATATTTTCTACCATAACTTTAATAAAACTCTACCAGCAATGCATTTTGTGGACCACAGTTTGCAAGTAGTACGTCTGGATAGCTGTCGACCAGGCTTTGGAAAAAATGAACGTCTACACAGTAATTGCGCTAGCTGTTGTGTGGTTTGTAGTCCTGCGACTTTTAGTCCTGATGTTAATGTAACTTGTCAGACCTGCGTTTCCGTCCTTACC------TATGGAGCTAAATCTTGCCCA
TRN  10010101100011000
NAM  ZPBP2_RAT/55-326
ASQ  MDIDRASKETVDPIYLWIGPNENTLTGSSQINITNIGELVLKDFMESLSGHYSCTLSYKIVKAETQEETSLKKKYDFLVFAYREPDYSYRMAVRFTTKSCVGRYNDLLFRLLKKILDNLISDLLCHVIEPSYKCHSVKIPERDFVYELFVAFQVNPFAPGWKSMCNS-SMDCEDVTNHNILKARDRIEEFFRSQAYILHHHFNITVPAMHFVDHSFQVTRIDNCRPGFGKNEGLHSNCASCCVVCSPGTFSPDMDVTCQTCVSAHV--YGAKACP
DSQ  ATGGATATTGATCGTGCTAGCAAAGAAACCGTGGATCCCATCTACTTATGGATTGGGCCGAATGAAAACACATTAACAGGGAGTAGCCAAATAAATATAACAAACATAGGAGAACTGGTACTGAAGGATTTTATGGAGTCATTATCTGGACATTACTCATGTACTCTTTCCTATAAAATTGTCAAAGCAGAAACCCAAGAAGAAACTTCACTAAAGAAGAAATATGACTTTCTGGTCTTTGCCTACCGGGAACCTGATTATTCTTATCGCATGGCTGTGCGTTTTACCACAAAATCTTGTGTAGGAAGATATAATGACCTGCTCTTTAGACTGCTGAAGAAAATCTTGGATAATTTAATCTCTGATTTGTTGTGCCATGTCATAGAACCATCTTATAAGTGCCATTCTGTTAAAATCCCAGAGAGGGACTTCGTGTACGAGCTATTCGTAGCCTTTCAAGTGAATCCTTTTGCACCCGGCTGGAAAAGTATGTGCAATAGC---TCTATGGACTGTGAGGACGTCACCAATCATAACATCCTCAAGGCACGAGATCGGATAGAAGAGTTTTTTCGGAGCCAAGCTTACATCCTGCACCACCACTTTAATATAACTGTCCCAGCTATGCACTTCGTGGACCACAGTTTCCAAGTAACTCGCATAGACAACTGTCGGCCAGGCTTTGGGAAAAACGAAGGTCTACACAGCAACTGTGCTAGCTGTTGCGTGGTCTGTAGTCCTGGAACGTTCAGTCCCGATATGGATGTCACCTGTCAGACCTGTGTTTCTGCCCATGTC------TACGGAGCCAAAGCTTGCCCA
TRN  10010101100011000
//