EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07188 - KSHV_K8)
FAM  PF07188
PID  KSHV_K8
DES  Kaposi's sarcoma-associated herpesvirus (KSHV) K8 protein
IPR  IPR010805
ANO  2
ALN  238
AID  1
APH  (Q9WRJ7_HHV8/1-189:0.00000,P88939_HHV8/1-238:0.00000);
ATP  (Q9WRJ7_HHV8/1-189,P88939_HHV8/1-238);
ATL  0
DNO  2
DLN  714
DID  1
DPH  (Q9WRJ7_HHV8/1-189:0.00000,P88939_HHV8/1-238:0.00000);
DTP  (Q9WRJ7_HHV8/1-189,P88939_HHV8/1-238);
DTL  0
RID  1
RPH  (Q9WRJ7_HHV8/1-189:0.00000,P88939_HHV8/1-238:0.00000);
RTP  (Q9WRJ7_HHV8/1-189,P88939_HHV8/1-238);
RTL  0
LNK  P88939_HHV8/1-238:P88939:U75698
LNK  Q9WRJ7_HHV8/1-189:Q9WRJ7:AF091349
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9WRJ7_HHV8/1-189
ASQ  MPRMKDIPTKSSPGTDNSEKDEAVIEEDLSLNGQPFFTDNTDGGENEVSWTSSLLSTYVGCQPPAIPVCETVIDLTAPSQSGAPGDEHLPCSLNAETKFHIPDPSWTLSHTPPRGPHISQQLPTRRSKRRLHRKFEEERLCTKAKQGAGRPVPASVVK-------------------------------------------------AEVCDQSHSPTRKQGRYGRVSSKAYTRQLQQ
DSQ  ATGCCCAGAATGAAGGACATACCTACTAAGAGTTCCCCGGGAACGGACAATTCTGAGAAAGATGAAGCTGTCATTGAGGAAGATCTAAGCCTCAACGGGCAACCATTTTTTACGGACAATACTGACGGTGGGGAAAACGAAGTCTCTTGGACAAGCTCGCTGTTGTCAACCTACGTAGGTTGCCAGCCCCCGGCCATACCGGTCTGTGAAACGGTCATTGACCTTACAGCGCCTTCCCAAAGTGGCGCGCCCGGTGACGAACATCTGCCATGCTCACTGAATGCAGAAACTAAATTCCACATCCCCGATCCTTCCTGGACGCTCTCTCACACACCACCAAGAGGACCACACATTTCGCAACAGCTTCCAACTCGCAGATCCAAGAGGCGACTACATAGAAAGTTTGAAGAGGAACGCTTATGCACTAAGGCCAAACAGGGCGCAGGTCGCCCCGTGCCTGCGTCTGTAGTTAAG---------------------------------------------------------------------------------------------------------------------------------------------------GCCGAAGTATGTGATCAGTCACATTCTCCCACGCGAAAGCAAGGCAGATACGGCCGCGTGTCATCGAAAGCATACACAAGACAGCTGCAGCAG
TRN  10010101100011000
NAM  P88939_HHV8/1-238
ASQ  MPRMKDIPTKSSPGTDNSEKDEAVIEEDLSLNGQPFFTDNTDGGENEVSWTSSLLSTYVGCQPPAIPVCETVIDLTAPSQSGAPGDEHLPCSLNAETKFHIPDPSWTLSHTPPRGPHISQQLPTRRSKRRLHRKFEEERLCTKAKQGAGRPVPASVVKVGNITPHYGEELTRGDAVPAAPITPPSPRVQRPAQPTHVLFSPVFVSLKAEVCDQSHSPTRKQGRYGRVSSKAYTRQLQQ
DSQ  ATGCCCAGAATGAAGGACATACCTACTAAGAGTTCCCCGGGAACGGACAATTCTGAGAAAGATGAAGCTGTCATTGAGGAAGATCTAAGCCTCAACGGGCAACCATTTTTTACGGACAATACTGACGGTGGGGAAAACGAAGTCTCTTGGACAAGCTCGCTGTTGTCAACCTACGTAGGTTGCCAGCCCCCGGCCATACCGGTCTGTGAAACGGTCATTGACCTTACAGCGCCTTCCCAAAGTGGCGCGCCCGGTGACGAACATCTGCCATGCTCACTGAATGCAGAAACTAAATTCCACATCCCCGATCCTTCCTGGACGCTCTCTCACACACCACCAAGAGGACCACACATTTCGCAACAGCTTCCAACTCGCAGATCCAAGAGGCGACTACATAGAAAGTTTGAAGAGGAACGCTTATGCACTAAGGCCAAACAGGGCGCAGGTCGCCCCGTGCCTGCGTCTGTAGTTAAGGTAGGGAACATCACCCCCCATTATGGGGAAGAACTGACAAGGGGTGACGCCGTCCCAGCCGCCCCTATAACACCCCCCTCCCCGCGCGTTCAACGCCCAGCACAGCCCACACATGTCCTGTTTTCTCCTGTTTTTGTCTCTTTAAAGGCCGAAGTATGTGATCAGTCACATTCTCCCACGCGAAAGCAAGGCAGATACGGCCGCGTGTCATCGAAAGCATACACAAGACAGCTGCAGCAG
TRN  10010101100011000
//