EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07178 - TraL)
FAM  PF07178
PID  TraL
DES  TraL protein
IPR  IPR009838
ANO  3
ALN  95
AID  0.286101
APH  (Q8D6A4_VIBVU/6-100:1.06402,TRAL_SALTI/7-101:0.67485,O85948_SPHAR/2-94:1.07650);
ATP  (Q8D6A4_VIBVU/6-100,TRAL_SALTI/7-101,O85948_SPHAR/2-94);
ATL  2.81537
DNO  3
DLN  285
DID  0.385349
DPH  (Q8D6A4_VIBVU/6-100:0.71533,TRAL_SALTI/7-101:0.45362,O85948_SPHAR/2-94:0.79535);
DTP  (Q8D6A4_VIBVU/6-100,TRAL_SALTI/7-101,O85948_SPHAR/2-94);
DTL  1.9643
RID  0.286101
RPH  (Q8D6A4_VIBVU/6-100:1.06402,TRAL_SALTI/7-101:0.67485,O85948_SPHAR/2-94:1.07650);
RTP  (Q8D6A4_VIBVU/6-100,TRAL_SALTI/7-101,O85948_SPHAR/2-94);
RTL  2.81537
LNK  O85948_SPHAR/2-94:O85948:AF079317
LNK  Q8D6A4_VIBVU/6-100:Q8D6A4:AE016810
LNK  TRAL_SALTI/7-101:P12058:M14733
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8D6A4_VIBVU/6-100
ASQ  LFFAIPKHLSKGKRISGLPRDEVLPGFLLFVLFFLAGKYLIGLIFAAIWFIGLRYIKVQYGENIIALTLYWWGNTSLNHSVFKHTPAAQKRYWLS
DSQ  CTTTTTTTTGCTATCCCAAAACACCTCAGCAAAGGCAAGCGCATATCAGGTTTACCCCGAGACGAAGTCTTGCCCGGGTTTCTTCTCTTTGTGCTCTTCTTCTTAGCCGGTAAATACTTGATAGGCCTTATCTTTGCAGCCATTTGGTTTATAGGACTTCGGTATATCAAAGTTCAGTACGGTGAAAACATCATCGCCTTAACCCTCTACTGGTGGGGGAACACCTCACTCAATCACAGTGTCTTCAAACACACTCCCGCAGCGCAAAAGCGTTACTGGCTCTCT
TRN  10010101110011000
NAM  TRAL_SALTI/7-101
ASQ  DKYRFPKTLSEQNRIIGLPLDEAIPAAVVLLWGFFTKKYLFSLIIAAVIWQLIRAAKCGKSSRWLYNWCYWYLPTELFRVVYRVIPDSSFRKWIK
DSQ  GACAAATACCGTTTCCCGAAAACCCTGTCAGAGCAGAACCGCATTATTGGACTGCCCCTTGATGAAGCTATCCCCGCAGCGGTTGTTTTGCTGTGGGGGTTTTTCACCAAGAAATATTTATTCAGTCTGATTATTGCGGCAGTTATCTGGCAACTGATCAGGGCGGCGAAATGTGGAAAAAGCTCCCGCTGGTTATACAACTGGTGTTATTGGTATCTACCCACTGAATTATTCCGGGTTGTCTACCGCGTTATTCCCGATTCCAGTTTCAGGAAATGGATAAAA
TRN  10010101100011000
NAM  O85948_SPHAR/2-94
ASQ  NRYTVPAHLDDPELIGFWTLDEFLAMIVPFAWGILSQHIFIGLCSSVLAWWGLRKLKAGRAVSWIIHSAYWYLPGAFMG--LRATPPSHLRLMAG
DSQ  AATCGCTACACGGTTCCCGCGCATCTCGATGATCCGGAGCTGATCGGGTTTTGGACACTCGATGAGTTTCTCGCGATGATCGTTCCCTTCGCCTGGGGCATCCTGTCTCAACATATTTTCATCGGTCTATGTTCAAGCGTGCTGGCCTGGTGGGGATTGCGCAAGTTGAAGGCGGGACGAGCCGTCTCGTGGATCATTCATTCGGCCTACTGGTACCTGCCGGGTGCCTTTATGGGG------CTGAGAGCGACGCCGCCCTCCCATCTTCGCCTGATGGCGGGC
TRN  10010101100011001
//