EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07175 - Osteoregulin)
FAM  PF07175
PID  Osteoregulin
DES  Osteoregulin
IPR  IPR009837
ANO  3
ALN  184
AID  0.507608
APH  (Q8K4L6_MOUSE/27-192:0.17870,Q8K3V0_RAT/27-186:0.29227,Q8NC19_HUMAN/76-256:0.71033);
ATP  (Q8K4L6_MOUSE/27-192,Q8K3V0_RAT/27-186,Q8NC19_HUMAN/76-256);
ATL  1.1813
DNO  3
DLN  552
DID  0.696617
DPH  (Q8K4L6_MOUSE/27-192:0.08112,Q8K3V0_RAT/27-186:0.14345,Q8NC19_HUMAN/76-256:0.41419);
DTP  (Q8K4L6_MOUSE/27-192,Q8K3V0_RAT/27-186,Q8NC19_HUMAN/76-256);
DTL  0.63876
RID  0.507608
RPH  (Q8K4L6_MOUSE/27-192:0.17870,Q8K3V0_RAT/27-186:0.29227,Q8NC19_HUMAN/76-256:0.71033);
RTP  (Q8K4L6_MOUSE/27-192,Q8K3V0_RAT/27-186,Q8NC19_HUMAN/76-256);
RTL  1.1813
LNK  Q8K3V0_RAT/27-186:Q8K3V0:AF530559
LNK  Q8K4L6_MOUSE/27-192:Q8K4L6:AF298661
LNK  Q8NC19_HUMAN/76-256:Q8NC19:AK075076
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8K4L6_MOUSE/27-192
ASQ  MPNEDRSSC------------------GNQDSIHKDLAASVYPDPTVDEGTEDGQGALLHPPGQDRYGAALLRNITQPVKSLVTGAELRREGNQEKRPQSVLSVIPADVNDAKVSLKDIKNQESYLLTQSSPVKSKHTKHTRQTRRSTHYLTHLPQIKKTPSDLEGSGSPDLLVRGDNDVPPFS
DSQ  ATGCCGAATGAAGACAGGAGCAGCTGC------------------------------------------------------GGCAATCAAGACAGCATTCACAAGGACTTGGCAGCATCTGTGTATCCTGATCCCACGGTGGATGAAGGCACAGAGGATGGGCAAGGTGCTCTCCTTCACCCGCCTGGCCAGGACAGGTATGGTGCTGCCCTCCTCAGAAATATCACGCAGCCTGTAAAGAGTCTAGTGACTGGGGCCGAACTACGGAGGGAAGGAAACCAGGAGAAGAGACCTCAGAGTGTTCTAAGCGTAATTCCAGCAGATGTCAATGATGCTAAAGTCTCCTTAAAAGACATAAAGAATCAAGAGAGTTATCTGCTAACCCAGAGCAGCCCGGTCAAAAGCAAACACACCAAACACACCCGCCAGACCCGACGGAGCACTCACTACCTGACACATCTCCCACAGATCAAGAAGACTCCCAGTGACCTTGAAGGCAGTGGCTCCCCAGATCTTCTAGTGAGGGGAGATAATGATGTCCCCCCTTTCAGT
TRN  10010101100011010
NAM  Q8K3V0_RAT/27-186
ASQ  KLNEDGSSG------------------GNQGNIH---LASVKPEPMVGKGTEGGRDAPLHLLDQNRQGATLLRNITQPVKSLVTGTEVQSDRNKEKKPQSVLSVIPTDVHNTNDYSEDTENQQRDLLLQNSPGQS---KHTPRARRSTHYLTHLPQIRKILSDFEDSASPDLLVRGDNDVPPFS
DSQ  AAGCTGAATGAAGATGGCAGCAGCGGC------------------------------------------------------GGTAACCAAGGCAACATCCAC---------TTAGCATCTGTGAAGCCTGAGCCCATGGTGGGTAAAGGAACAGAGGGTGGGCGAGATGCTCCCCTTCACCTGCTTGACCAGAACAGGCAGGGTGCCACCCTCCTCAGAAATATCACTCAGCCTGTAAAGAGTCTGGTGACGGGGACTGAAGTACAGAGCGACAGAAACAAAGAGAAGAAACCTCAGAGTGTTCTAAGCGTAATTCCAACAGATGTCCACAATACTAACGACTACTCAGAAGATACAGAGAACCAACAGAGGGATCTACTACTCCAGAACAGCCCAGGACAAAGC---------AAACACACCCCTCGGGCCCGACGAAGCACGCACTACCTAACACATCTCCCCCAAATCAGAAAGATTCTCAGTGACTTCGAGGACAGTGCTTCCCCAGACCTTCTAGTGAGGGGGGATAATGATGTCCCTCCTTTCAGT
TRN  10010101100011000
NAM  Q8NC19_HUMAN/76-256
ASQ  EASENKGSSKSQNYFTNRQRLNKEYSISNKENTHNGLRMSIYPKSTGNKGFEDGDDAISKLHDQEEYGAALIRNNMQHIMGPVTAIKLLGEENKENTPRNVLNIIPASMNYAKAHSKDKKKPQRDSQAQKSPVKS---KSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGDNDISPFR
DSQ  GAAGCCAGTGAGAATAAGGGAAGTAGTAAATCTCAAAATTATTTCACAAATAGACAGAGACTGAATAAAGAATATAGTATCAGTAACAAAGAGAATACTCACAATGGCCTGAGGATGTCAATTTATCCTAAGTCAACTGGGAATAAAGGGTTTGAGGATGGAGATGATGCTATCAGCAAACTACATGACCAAGAAGAATATGGCGCAGCTCTCATCAGAAATAACATGCAACATATAATGGGGCCAGTGACTGCGATTAAACTCCTGGGGGAAGAAAACAAAGAGAACACACCTAGGAATGTTCTAAACATAATCCCAGCAAGTATGAATTATGCTAAAGCACACTCGAAGGATAAAAAGAAGCCTCAAAGAGATTCCCAAGCCCAGAAAAGTCCAGTAAAAAGC---------AAAAGCACCCATCGTATTCAACACAACATTGACTACCTAAAACATCTCTCAAAAGTCAAAAAAATCCCCAGTGATTTTGAAGGCAGCGGTTATACAGATCTTCAAGAGAGAGGGGACAATGATATATCTCCTTTCAGG
TRN  10010101100011001
//