EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07158 - MatC_N)
FAM  PF07158
PID  MatC_N
DES  Dicarboxylate carrier protein MatC N-terminus
IPR  IPR009827
ANO  5
ALN  149
AID  0.434942
APH  (Q9ZIP4_RHILE/1-149:0.23850,Q8P4U0_XANCP/1-149:0.28551,((P72556_STRPN/1-148:1.72319,Q9KIE8_STRHY/1-149:0.34831):0.26149,Q9L0A3_STRCO/1-149:0.14154):0.15469);
ATP  (Q9ZIP4_RHILE/1-149,Q8P4U0_XANCP/1-149,((P72556_STRPN/1-148,Q9KIE8_STRHY/1-149),Q9L0A3_STRCO/1-149));
ATL  3.15323
DNO  5
DLN  447
DID  0.53416
DPH  (Q9ZIP4_RHILE/1-149:0.09103,((Q9KIE8_STRHY/1-149:0.40464,Q9L0A3_STRCO/1-149:0.10400):0.13797,Q8P4U0_XANCP/1-149:0.20387):0.13742,P72556_STRPN/1-148:0.97001);
DTP  (Q9ZIP4_RHILE/1-149,((Q9KIE8_STRHY/1-149,Q9L0A3_STRCO/1-149),Q8P4U0_XANCP/1-149),P72556_STRPN/1-148);
DTL  2.04894
RID  0.434942
RPH  (Q9ZIP4_RHILE/1-149:0.23850,Q8P4U0_XANCP/1-149:0.28551,((P72556_STRPN/1-148:1.72319,Q9KIE8_STRHY/1-149:0.34831):0.26149,Q9L0A3_STRCO/1-149:0.14154):0.15469);
RTP  (Q9ZIP4_RHILE/1-149,Q8P4U0_XANCP/1-149,((P72556_STRPN/1-148,Q9KIE8_STRHY/1-149),Q9L0A3_STRCO/1-149));
RTL  3.15323
LNK  P72556_STRPN/1-148:P72556:U66846
LNK  Q8P4U0_XANCP/1-149:Q8P4U0:AE012482
LNK  Q9KIE8_STRHY/1-149:Q9KIE8:AF235504
LNK  Q9L0A3_STRCO/1-149:Q9L0A3:AL939112
LNK  Q9ZIP4_RHILE/1-149:Q9ZIP4:AF117694
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZIP4_RHILE/1-149
ASQ  MGIELLSIGLLIAMFIIATIQPINMGALAFAGAFVLGSMIIGMKTNEIFAGFPSDLFLTLVAVTYLFAIAQINGTIDWLVECAVRLVRGRIGLIPWVMFLVAAIITGFGALGPAAVAILAPVALSFAVQYRIHPVMMGLMVIHGAQAGG
DSQ  ATGGGTATTGAATTACTGTCCATAGGCCTGCTGATCGCCATGTTCATCATTGCGACGATCCAGCCAATCAACATGGGTGCGCTCGCCTTTGCCGGCGCCTTCGTGCTCGGCTCGATGATCATCGGGATGAAAACCAACGAAATATTTGCCGGCTTTCCGAGTGATCTGTTCCTGACGCTCGTCGCCGTCACCTACCTCTTCGCCATAGCGCAGATCAACGGCACGATCGACTGGCTCGTCGAATGTGCCGTCCGCCTGGTACGCGGGCGGATCGGCTTGATTCCCTGGGTGATGTTCCTTGTCGCCGCCATCATTACTGGCTTCGGTGCACTTGGGCCTGCTGCGGTCGCCATTCTCGCACCCGTCGCGTTGAGCTTTGCCGTGCAGTACCGCATTCATCCGGTGATGATGGGTCTGATGGTGATCCACGGCGCGCAGGCAGGCGGC
TRN  10010101100011010
NAM  Q8P4U0_XANCP/1-149
ASQ  MTPQIATILGLVIMFIVATALPINMGAVAFALAFIIGGVWVGLDGKEVLAGFPGDLFLTLVGITYLFAIAQKNGTIDLLVHWAVRAVRGRIVAIPWVMFVITGLLTAFGALGPAAVAIIGPVALRFAKQYRINPLMMGLLVIHGAQGGG
DSQ  ATGACCCCGCAAATTGCAACGATTCTTGGCTTGGTGATCATGTTCATCGTGGCCACCGCATTGCCCATCAACATGGGTGCGGTGGCCTTCGCGCTGGCCTTCATCATCGGTGGCGTGTGGGTGGGGCTGGACGGCAAGGAGGTCCTGGCCGGCTTCCCGGGCGATCTGTTCCTCACCCTGGTCGGCATCACCTATCTGTTCGCCATCGCGCAGAAGAACGGCACCATCGATCTGCTGGTGCACTGGGCGGTCCGCGCAGTGCGTGGGCGCATTGTGGCCATCCCGTGGGTGATGTTCGTCATCACCGGCCTGCTCACCGCGTTTGGTGCGTTGGGGCCGGCGGCAGTGGCCATCATCGGCCCGGTGGCACTGCGCTTTGCCAAGCAATACCGCATCAATCCCTTGATGATGGGCCTGCTGGTGATCCACGGCGCGCAGGGCGGCGGG
TRN  11011111101111111
NAM  Q9L0A3_STRCO/1-149
ASQ  MSPELISILVLVVVFVIATTRSVNMGALAFAAAFGVGTLVADLDADGIFAGFPGDLFVVLVGVTYLFAIARANGTTDWLVHAAVRLVRGRVALIPWVMFALTGALTAIGAVSPAAVAIVAPVALSFATRYSISPLLMGTMVVHGAQAGG
DSQ  ATGTCCCCCGAACTCATCTCGATCCTCGTCCTCGTCGTGGTGTTCGTCATCGCCACCACCCGCTCCGTCAACATGGGCGCGCTCGCCTTCGCCGCCGCGTTCGGGGTGGGCACGCTCGTCGCCGACCTCGACGCGGACGGCATCTTCGCCGGGTTCCCCGGCGACCTGTTCGTCGTCCTGGTCGGCGTCACCTACCTGTTCGCGATCGCCCGGGCCAACGGCACCACCGACTGGCTGGTGCACGCGGCCGTCCGGCTGGTGAGGGGCCGGGTCGCGCTGATCCCCTGGGTGATGTTCGCGCTGACCGGCGCGCTCACGGCGATCGGCGCGGTCAGCCCGGCCGCGGTCGCGATCGTCGCGCCGGTCGCCCTGAGCTTCGCCACCCGGTACTCGATCAGCCCGCTGCTCATGGGCACGATGGTGGTGCACGGCGCGCAGGCCGGCGGG
TRN  10010101100011011
NAM  Q9KIE8_STRHY/1-149
ASQ  MPNELTGVLILAAVFLLAGVRGLNMGLLALVATFLLGVVALDRTPDEVLAGFPASMFLVLVAVTFLFGIARVNGTVDWLVRVAVRAVGARVGAVPWVLFGLAALLCATGAASPAAVAIVAPISVAFAVRHRIDPLYAGLMAVNGAAAGS
DSQ  ATGCCGAATGAACTCACCGGAGTCCTGATCCTGGCCGCCGTGTTCCTGCTCGCCGGCGTACGGGGGCTGAACATGGGCCTGCTCGCGCTGGTCGCCACCTTTCTGCTCGGGGTGGTCGCACTCGACCGAACGCCGGACGAGGTGCTGGCGGGTTTCCCCGCGAGCATGTTCCTGGTGCTGGTCGCCGTCACGTTCCTCTTCGGGATCGCCCGCGTCAACGGCACGGTGGACTGGCTGGTACGTGTCGCGGTGCGGGCGGTGGGGGCCCGGGTGGGAGCCGTCCCCTGGGTGCTCTTCGGCCTGGCGGCACTGCTCTGCGCGACAGGCGCGGCCTCGCCCGCGGCGGTGGCGATCGTGGCGCCGATCAGCGTCGCGTTCGCCGTCAGGCACCGCATCGATCCGCTGTACGCCGGACTGATGGCGGTGAACGGGGCCGCAGCCGGCAGT
TRN  10010101100011011
NAM  P72556_STRPN/1-148
ASQ  M-IHLIMISAIALAIGIGYRTKINIDLLAIAFSYLIATTLMGLSPKELLHFWPTSLFFTIFSVSLFYNFAITNGTLDVLAQHILYRTRTYPNALYMILYLMATLLSALGAGFFTTMAVCCPLAITLCQKVYKHPLIGAQAVNWGASGGA
DSQ  ATG---ATTCATTTAATAATGATTAGCGCCATTGCTCTAGCCATTGGAATTGGTTACCGCACCAAAATCAATATTGACCTGCTGGCTATTGCTTTTTCTTACCTCATCGCAACCACTCTCATGGGATTAAGCCCCAAAGAACTTCTTCATTTTTGGCCAACCTCACTCTTTTTTACCATTTTTAGCGTCTCTCTCTTTTATAACTTTGCAATAACTAACGGTACTCTTGATGTTTTGGCTCAACACATTCTCTACCGCACACGCACCTACCCTAACGCCCTCTACATGATTTTATACCTGATGGCAACCCTTTTGTCTGCTTTAGGTGCTGGATTTTTCACTACTATGGCCGTTTGCTGTCCTCTAGCGATTACCCTCTGTCAAAAAGTGTACAAACACCCTTTGATTGGAGCTCAAGCCGTCAATTGGGGAGCTTCAGGAGGGGCT
TRN  10010101100011000
//