EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07157 - DNA_circ_N)
FAM  PF07157
PID  DNA_circ_N
DES  DNA circulation protein N-terminus
IPR  IPR009826
ANO  10
ALN  97
AID  0.39813
APH  (((((Q8EDP5_SHEON/2-94:0.57755,(VPN_HAEIN/2-95:0.22692,(VPN_BPMU/19-115:0.28325,Q8X2Y1_ECO57/8-101:0.45272):0.28982):0.32859):0.19857,(Q88A16_PSESM/4-96:0.43310,Q88G61_PSEPK/4-96:0.37087):0.15153):0.21289,Q8SBG8_BPSF5/8-100:0.15462):0.13528,Q8HAC1_9CAUD/9-101:0.21215):0.67942,Q9JR33_NEIMA/3-95:0.56907,Q9JZC9_NEIMB/4-96:0.42418);
ATP  (((((Q8EDP5_SHEON/2-94,(VPN_HAEIN/2-95,(VPN_BPMU/19-115,Q8X2Y1_ECO57/8-101))),(Q88A16_PSESM/4-96,Q88G61_PSEPK/4-96)),Q8SBG8_BPSF5/8-100),Q8HAC1_9CAUD/9-101),Q9JR33_NEIMA/3-95,Q9JZC9_NEIMB/4-96);
ATL  5.697
DNO  10
DLN  291
DID  0.468035
DPH  ((((Q8EDP5_SHEON/2-94:0.51316,(VPN_HAEIN/2-95:0.22623,(VPN_BPMU/19-115:0.29996,Q8X2Y1_ECO57/8-101:0.41320):0.16740):0.18725):0.12942,(Q88A16_PSESM/4-96:0.29314,Q88G61_PSEPK/4-96:0.36433):0.12627):0.03937,(Q8SBG8_BPSF5/8-100:0.23440,Q8HAC1_9CAUD/9-101:0.34785):0.08376):0.39358,Q9JR33_NEIMA/3-95:0.31101,Q9JZC9_NEIMB/4-96:0.38090);
DTP  ((((Q8EDP5_SHEON/2-94,(VPN_HAEIN/2-95,(VPN_BPMU/19-115,Q8X2Y1_ECO57/8-101))),(Q88A16_PSESM/4-96,Q88G61_PSEPK/4-96)),(Q8SBG8_BPSF5/8-100,Q8HAC1_9CAUD/9-101)),Q9JR33_NEIMA/3-95,Q9JZC9_NEIMB/4-96);
DTL  4.51123
RID  0.39813
RPH  (((((Q8EDP5_SHEON/2-94:0.57755,(VPN_HAEIN/2-95:0.22692,(VPN_BPMU/19-115:0.28325,Q8X2Y1_ECO57/8-101:0.45272):0.28982):0.32859):0.19857,(Q88A16_PSESM/4-96:0.43310,Q88G61_PSEPK/4-96:0.37087):0.15153):0.21289,Q8SBG8_BPSF5/8-100:0.15462):0.13528,Q8HAC1_9CAUD/9-101:0.21215):0.67942,Q9JR33_NEIMA/3-95:0.56907,Q9JZC9_NEIMB/4-96:0.42418);
RTP  (((((Q8EDP5_SHEON/2-94,(VPN_HAEIN/2-95,(VPN_BPMU/19-115,Q8X2Y1_ECO57/8-101))),(Q88A16_PSESM/4-96,Q88G61_PSEPK/4-96)),Q8SBG8_BPSF5/8-100),Q8HAC1_9CAUD/9-101),Q9JR33_NEIMA/3-95,Q9JZC9_NEIMB/4-96);
RTL  5.697
LNK  Q88A16_PSESM/4-96:Q88A16:AE016857
LNK  Q88G61_PSEPK/4-96:Q88G61:AE016788
LNK  Q8EDP5_SHEON/2-94:Q8EDP5:AE015709
LNK  Q8HAC1_9CAUD/9-101:Q8HAC1:AY055382
LNK  Q8SBG8_BPSF5/8-100:Q8SBG8:U82619
LNK  Q8X2Y1_ECO57/8-101:Q8X2Y1:BA000007
LNK  Q9JR33_NEIMA/3-95:Q9JR33:AL162757
LNK  Q9JZC9_NEIMB/4-96:Q9JZC9:AE002460
LNK  VPN_BPMU/19-115:P08557:AF083977
LNK  VPN_HAEIN/2-95:P71389:U32827
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9JZC9_NEIMB/4-96
ASQ  WHTLLQDASYKGVGFDIEVVD-ESNGKALAEHARPFVQGIDLEDMGMTGRQVQINAVFWGKGYAGRLKK---LLDALEQPGGGVLVHPVWGRMHNMI
DSQ  TGGCATACCTTATTGCAGGACGCATCTTACAAGGGCGTCGGCTTTGATATTGAGGTGGTGGAC---GAGAGCAACGGCAAGGCATTGGCCGAGCATGCGCGGCCGTTTGTGCAGGGTATCGACCTTGAAGACATGGGCATGACCGGGCGGCAGGTGCAGATTAATGCGGTGTTTTGGGGCAAGGGCTATGCAGGCCGTCTGAAAAAG---------CTGCTGGATGCGCTGGAGCAGCCGGGCGGCGGCGTGCTGGTGCACCCTGTTTGGGGGCGGATGCACAACATGATT
TRN  11011101101011010
NAM  Q9JR33_NEIMA/3-95
ASQ  WKDTLLDAGFKGVTFDVIDDT-LRGTHALAEHEYPFVQGADIEDTGVSAMDMALTAVLWGEDYEGRLQN---LLNVLCETGAGELIHPIYGSVPDCV
DSQ  TGGAAAGACACTTTACTGGATGCGGGCTTCAAGGGCGTTACCTTTGACGTCATCGACGACACG---CTGCGCGGCACCCACGCGCTGGCGGAACACGAATACCCGTTCGTACAGGGCGCGGACATCGAAGATACGGGTGTATCTGCGATGGATATGGCCTTGACCGCCGTATTGTGGGGTGAAGATTACGAAGGCCGCCTGCAAAAC---------CTGCTGAACGTATTGTGCGAAACGGGCGCGGGCGAATTGATCCACCCGATTTACGGCAGCGTGCCAGATTGCGTA
TRN  11011101101011010
NAM  Q8X2Y1_ECO57/8-101
ASQ  MASGDGRGAFRGVPFLVWREQRERGGRNIVRREYPLRETGGADDLGPKLAEFTFSVLVMGDDVQTQRNR---LRDALRAPGAGELLHPDYGTLNVLI
DSQ  ATGGCCTCTGGTGACGGTCGTGGTGCGTTCCGTGGTGTGCCGTTCCTCGTCTGGCGTGAGCAGCGCGAACGTGGCGGGCGAAACATTGTCCGTCGGGAATATCCGTTACGGGAAACCGGTGGTGCAGACGATCTGGGACCTAAACTGGCTGAATTTACGTTCAGTGTACTTGTGATGGGGGATGATGTTCAGACACAGCGAAATCGT---------CTGCGTGATGCCCTTCGTGCTCCCGGTGCCGGGGAGCTGCTTCACCCGGATTACGGCACGTTAAATGTGCTGATA
TRN  10010101100011010
NAM  VPN_BPMU/19-115
ASQ  GRKTTGKGTFRNVPFLVIEEQKQAGGRRLVKREYPLRDTGGVNDLGKKLRSRTFSACILNSNAETARDEAGALMDALDAPGSGELVHPDFGTVDVMV
DSQ  GGCAGGAAAACAACCGGCAAAGGCACGTTCCGTAACGTGCCGTTTCTCGTCATCGAGGAGCAAAAACAGGCTGGCGGACGTCGCCTGGTTAAACGCGAGTACCCGTTACGTGATACCGGCGGCGTCAATGACCTGGGGAAAAAGCTTCGCTCCCGTACATTCAGCGCCTGCATTCTGAACAGCAACGCAGAAACAGCCAGAGATGAAGCGGGTGCGCTGATGGATGCTCTTGATGCTCCGGGTAGCGGTGAGCTGGTACATCCTGATTTCGGCACTGTGGACGTCATGGTG
TRN  10010101100011010
NAM  VPN_HAEIN/2-95
ASQ  ASKITGKGSFRGVPFLIEEEQGLDGGRRIVSHEYPLRDEGLTEDMGKRLRRYQVSCLVIGDDHLAQAEK---LIDALEASGAGTLKHPYFGTIEVRV
DSQ  GCAAGTAAGATTACAGGTAAAGGTAGCTTTCGTGGTGTGCCTTTTCTTATTGAAGAAGAGCAAGGCTTAGACGGAGGTCGCCGTATTGTCTCACACGAATATCCGTTGCGTGATGAGGGTTTAACCGAAGATATGGGCAAACGCCTGCGCCGTTATCAAGTCTCTTGCTTAGTTATCGGTGACGATCACTTAGCACAGGCAGAAAAA---------CTGATTGACGCCCTTGAAGCCAGTGGTGCAGGCACGCTCAAGCACCCTTACTTTGGCACTATTGAGGTGCGGGTG
TRN  11011101101011000
NAM  Q8SBG8_BPSF5/8-100
ASQ  WKDRLQDASFRGVPFKVEEES-AGTGRRVETHEYPNRDKPYTEDLGKVTFRPSITAYVVGDDCFDQRDR---LIDALNKPGPGTLVHPTYGELKVCV
DSQ  TGGAAAGACAGGCTTCAGGACGCGTCATTTCGCGGTGTACCGTTTAAGGTCGAAGAAGAAAGT---GCGGGAACAGGTCGCCGTGTGGAAACGCACGAATACCCGAACCGCGACAAACCCTATACCGAAGATCTGGGAAAAGTCACTTTCCGCCCGTCCATCACGGCTTATGTGGTGGGAGATGACTGCTTTGACCAGCGCGATCGC---------CTGATTGACGCGCTGAATAAACCCGGTCCCGGCACGCTTGTCCATCCGACATACGGTGAGCTGAAAGTCTGTGTT
TRN  10010101100011001
NAM  Q8HAC1_9CAUD/9-101
ASQ  WRGRLRDASFRGVPFSVEDDE-STFGRRVQVHEYPNRDKPWTEDLGRATRRLTINAYLVGDDYADRRDR---LIGAIETAGPGTLVHPQYGEMQGSI
DSQ  TGGCGCGGGCGCCTGCGTGATGCATCATTTCGTGGAGTGCCTTTCTCCGTTGAAGATGATGAA---AGCACCTTTGGACGCCGCGTACAGGTACATGAATATCCGAACAGGGATAAGCCCTGGACGGAGGATTTAGGTCGCGCCACGCGCCGCCTGACGATAAATGCTTATCTTGTCGGTGATGATTACGCAGACAGGCGGGATCGT---------CTTATTGGTGCCATTGAAACCGCAGGCCCTGGTACGCTGGTCCATCCGCAGTATGGCGAAATGCAGGGCAGCATT
TRN  10010101100011000
NAM  Q88G61_PSEPK/4-96
ASQ  WRDLRREASFRGVPFWVDSDS-VPVGRRTQLHEYPKRDQPLVEDMGRQTREYKFDGFIIGPDFISQRDR---LLVALDTPGPGELVHPWFGRLTVTA
DSQ  TGGCGTGATTTGCGACGCGAGGCGTCGTTTCGCGGCGTGCCGTTCTGGGTTGACAGCGACAGC---GTGCCGGTCGGCCGGCGCACCCAGCTGCACGAATACCCCAAGCGTGACCAGCCGTTGGTGGAGGACATGGGCCGGCAGACCCGTGAATACAAGTTCGACGGCTTTATCATCGGCCCGGACTTCATCAGCCAGCGTGACCGC---------TTGCTGGTTGCGCTGGACACGCCGGGGCCTGGCGAACTTGTACACCCGTGGTTCGGGCGCCTGACCGTCACGGCG
TRN  11011111101111111
NAM  Q88A16_PSESM/4-96
ASQ  WRDSLLPASFRGVGFFIEKAV-VPVGRKGQLHEFPQRDEPYFESLGKQAQVHTLTAFIVGRDCFEKRDN---LLQALEKDGAGELVHPWLGRMQVQV
DSQ  TGGCGTGACAGCCTGCTGCCAGCGTCTTTCCGTGGTGTCGGTTTTTTCATTGAAAAAGCCGTC---GTCCCGGTGGGTCGCAAAGGGCAGTTGCATGAATTTCCACAGCGCGACGAGCCTTACTTCGAGTCGCTGGGCAAGCAGGCGCAGGTTCATACGCTGACGGCTTTTATTGTCGGTCGCGACTGTTTTGAAAAACGGGACAAC---------TTGCTTCAGGCGCTGGAGAAGGACGGTGCGGGTGAGCTGGTGCACCCGTGGCTGGGGCGCATGCAGGTACAGGTC
TRN  11011101101011011
NAM  Q8EDP5_SHEON/2-94
ASQ  AFEDRLTASFRGVEFLLEEAD-GESGRRAIPHAYPKKEIGYTEDNGKVLTQERISGRVVGADYFEQLQA---LLEALNKQGPGELVHPWFGIRKVQI
DSQ  GCATTCGAAGACCGTTTAACCGCCTCGTTTCGAGGCGTTGAATTTTTACTCGAAGAGGCCGAT---GGTGAAAGCGGCCGTCGTGCGATCCCCCACGCGTACCCCAAAAAAGAAATTGGTTACACCGAAGATAACGGCAAAGTACTCACCCAAGAGCGTATTAGTGGCCGTGTAGTGGGTGCCGACTATTTTGAGCAATTGCAAGCA---------CTGCTTGAGGCATTAAATAAGCAAGGGCCAGGTGAATTAGTTCACCCTTGGTTTGGTATTCGCAAAGTTCAAATT
TRN  11011101101011010
//