EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07155 - DUF1393)
FAM  PF07155
PID  DUF1393
DES  Protein of unknown function (DUF1393)
IPR  IPR009825
ANO  8
ALN  182
AID  0.478906
APH  ((Q88ZZ1_LACPL/6-185:0.45498,(((Q97SA4_STRPN/4-182:0.35600,(Q87G36_VIBPA/2-182:0.96917,Q93D98_STRMU/3-181:0.23705):0.02487):0.13396,Q8DY59_STRA5/33-212:0.32005):0.08072,Q9CIN2_LACLA/3-182:0.25777):0.20868):0.09550,Q99QV6_STAAM/5-184:0.34950,Q8XK19_CLOPE/5-184:0.31002);
ATP  ((Q88ZZ1_LACPL/6-185,(((Q97SA4_STRPN/4-182,(Q87G36_VIBPA/2-182,Q93D98_STRMU/3-181)),Q8DY59_STRA5/33-212),Q9CIN2_LACLA/3-182)),Q99QV6_STAAM/5-184,Q8XK19_CLOPE/5-184);
ATL  3.79827
DNO  8
DLN  546
DID  0.559806
DPH  (((Q9CIN2_LACLA/3-182:0.27981,((Q87G36_VIBPA/2-182:0.61915,(Q97SA4_STRPN/4-182:0.26965,Q93D98_STRMU/3-181:0.20370):0.07326):0.08099,Q8DY59_STRA5/33-212:0.22474):0.07499):0.09767,Q88ZZ1_LACPL/6-185:0.41270):0.04984,Q8XK19_CLOPE/5-184:0.27121,Q99QV6_STAAM/5-184:0.26096);
DTP  (((Q9CIN2_LACLA/3-182,((Q87G36_VIBPA/2-182,(Q97SA4_STRPN/4-182,Q93D98_STRMU/3-181)),Q8DY59_STRA5/33-212)),Q88ZZ1_LACPL/6-185),Q8XK19_CLOPE/5-184,Q99QV6_STAAM/5-184);
DTL  2.91867
RID  0.478906
RPH  ((Q88ZZ1_LACPL/6-185:0.45498,(((Q97SA4_STRPN/4-182:0.35600,(Q87G36_VIBPA/2-182:0.96917,Q93D98_STRMU/3-181:0.23705):0.02487):0.13396,Q8DY59_STRA5/33-212:0.32005):0.08072,Q9CIN2_LACLA/3-182:0.25777):0.20868):0.09550,Q99QV6_STAAM/5-184:0.34950,Q8XK19_CLOPE/5-184:0.31002);
RTP  ((Q88ZZ1_LACPL/6-185,(((Q97SA4_STRPN/4-182,(Q87G36_VIBPA/2-182,Q93D98_STRMU/3-181)),Q8DY59_STRA5/33-212),Q9CIN2_LACLA/3-182)),Q99QV6_STAAM/5-184,Q8XK19_CLOPE/5-184);
RTL  3.79827
LNK  Q87G36_VIBPA/2-182:Q87G36:BA000032
LNK  Q88ZZ1_LACPL/6-185:Q88ZZ1:AL935252
LNK  Q8DY59_STRA5/33-212:Q8DY59:AE014266
LNK  Q8XK19_CLOPE/5-184:Q8XK19:BA000016
LNK  Q93D98_STRMU/3-181:Q93D98:AF397166
LNK  Q97SA4_STRPN/4-182:Q97SA4:AE007360
LNK  Q99QV6_STAAM/5-184:Q99QV6:BA000017
LNK  Q9CIN2_LACLA/3-182:Q9CIN2:AE006269
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CIN2_LACLA/3-182
ASQ  NNSVKIVVATGIGAALFVIIGWLINIPTPIPNTSIQLQYAVLALFSALFGPLAGFLIGFIGHALKDSFLYGAPWWTWVLGSGLIGLFLAFGVK--RETLTQGIFGNKEIIRFNIVQFLANVVVWGIIAPIGDVLVYSEPANKVFTQGIVAGLVNALTIAVAGTLLLKLYAATRTKSGSLDKE
DSQ  AATAACTCTGTAAAAATTGTTGTTGCCACTGGGATTGGGGCTGCTTTGTTTGTGATTATTGGTTGGCTAATTAATATTCCTACACCAATTCCAAATACTAGTATTCAATTGCAATATGCGGTCCTTGCCCTATTTTCAGCCTTATTTGGCCCTTTAGCTGGTTTCTTGATCGGATTTATTGGTCATGCCCTTAAAGATTCATTTCTCTATGGTGCGCCTTGGTGGACTTGGGTTTTAGGCTCAGGTTTAATAGGCTTATTTCTAGCTTTTGGAGTCAAA------AGAGAAACTTTGACTCAAGGAATTTTTGGAAATAAAGAAATCATTCGTTTTAATATTGTTCAATTTTTAGCCAATGTCGTAGTTTGGGGAATTATTGCTCCAATTGGGGATGTTTTAGTTTATAGTGAACCGGCAAATAAGGTCTTCACACAAGGAATTGTTGCTGGTTTAGTAAATGCATTGACTATTGCCGTAGCAGGAACTTTACTACTCAAACTCTATGCTGCTACCAGAACCAAATCTGGCTCACTCGATAAAGAA
TRN  10010101110011000
NAM  Q8DY59_STRA5/33-212
ASQ  TNTIKKVVATGIGAALFIIIGMLVNIPTPIPNTNIQLQYAVLALFAVIYGPGVGFFTGFIGHALKDSIQYGSPWWTWVLVSGLLGLMIGFFAK--KLAIQLSGMTKKDLLLFNVVQVIANLIGWSVVAPYGDIFFYSEPASKVFAQGFLSSLVNSITIGVGGTLLLLAYAKSRPQKGSLSKD
DSQ  ACAAACACAATAAAAAAGGTTGTAGCGACTGGAATTGGAGCTGCACTTTTTATCATTATAGGTATGCTAGTTAATATACCAACACCAATTCCAAATACTAATATTCAATTGCAGTATGCAGTTTTAGCATTATTTGCAGTTATTTATGGACCAGGAGTTGGTTTTTTTACTGGTTTTATCGGACACGCATTGAAAGATTCGATTCAATATGGTTCTCCGTGGTGGACTTGGGTTTTAGTTAGTGGTCTTTTAGGTTTGATGATAGGCTTTTTTGCTAAA------AAATTAGCTATTCAATTATCTGGCATGACTAAGAAGGATTTGCTTCTATTTAATGTAGTTCAAGTTATTGCTAACCTTATAGGTTGGTCTGTCGTTGCACCGTATGGTGATATTTTCTTTTATAGCGAACCTGCAAGCAAAGTTTTTGCACAAGGTTTCTTATCAAGCCTTGTGAATTCCATTACTATTGGAGTAGGTGGTACGCTTTTGTTGCTAGCATACGCTAAATCACGACCACAAAAAGGTAGTTTATCCAAAGAT
TRN  10010101110011000
NAM  Q93D98_STRMU/3-181
ASQ  NNSIKAVVATGIGAALFVIIGMFINIPL-FANTSIQLQYAVQAFLAVIFGPVVGFFIGLIGHMVKDMFAGYGIWWSWVIPSGLVGLGIGFLRN--RLHVEKGIFSTKDVVTFNIVQVLVNVLAWGVIAPLGDIIIFKEPASKVFVQGLLASVANALTVGVGATILLAIYAKSRTQAGSLSKD
DSQ  AATAATTCAATTAAAGCAGTTGTCGCAACAGGGATTGGAGCAGCCTTATTTGTTATTATTGGTATGTTTATCAATATTCCACTC---TTTGCTAATACAAGTATTCAGCTGCAATATGCTGTTCAAGCCTTTTTAGCTGTTATTTTTGGTCCAGTTGTCGGCTTCTTTATTGGTTTAATCGGTCATATGGTAAAAGATATGTTTGCTGGTTATGGTATTTGGTGGTCATGGGTTATTCCAAGCGGCCTTGTTGGTCTTGGAATTGGTTTTTTGAGAAAT------CGTCTTCATGTTGAAAAGGGAATCTTTTCAACTAAAGATGTTGTTACCTTTAATATTGTTCAAGTGCTGGTAAACGTTCTTGCTTGGGGAGTTATCGCACCTCTTGGCGATATCATTATTTTTAAAGAGCCAGCAAGCAAGGTTTTTGTTCAAGGTTTGTTAGCTAGTGTTGCCAATGCTCTAACAGTTGGTGTTGGCGCTACCATTCTTTTGGCTATTTATGCAAAAAGTCGGACACAAGCAGGAAGTTTATCAAAAGAT
TRN  10010101100011000
NAM  Q97SA4_STRPN/4-182
ASQ  KFTIKQVVAVGIGAALFVVIGM-INIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVGLIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRK--YVRVINGVFDWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGTLLLLAYAGTQTRAGSLKKD
DSQ  AAATTTACAATTAAACAAGTTGTTGCTGTCGGAATTGGCGCTGCCCTCTTTGTCGTCATCGGGATG---ATCAACATTCCAACCCCTGTTCCAAATACAAGCATCCAGCTTCAGTATGCGGTACAAGCGCTACTTTCTATTATTTTTGGACCGATTATCGGTTTGCTTGTCGGGTTGATTGGTCATGCAATCAAGGACTCTCTTGTTGGTTATGGTCTATGGTGGACTTGGATTATCGCTAGCGGACTCTTTGGTTTAGTTGTGGGACTTTTTAGAAAG------TACGTTCGCGTGATCAATGGTGTTTTTGACTGGAAAGATATTCTTATTTTTAATCTCATTCAACTACTTGCAAATGCCCTTGTTTGGGGTGTCTTGGCACCACTTGGAGATGTTGTGATTTATCAAGAAGCGGCAGAAAAAGTATTTGCACAAGGGATTGTTGCGGGAATTGCCAATGGTGTATCTGTAGCTATTGCAGGAACTCTTCTCTTACTTGCCTATGCAGGAACCCAAACTCGTGCAGGAAGTTTGAAAAAGGAC
TRN  10010101110011010
NAM  Q99QV6_STAAM/5-184
ASQ  DISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLMTGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGL--KLNLSSGLFSRKSMIYFNIGQIIANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGSLRKE
DSQ  GATATTTCAGTTAAAACTGTTGTTGCGATTGGTATAGGAGCAGCGGTATTTGTGATTTTAGGGCGTTTTGTTGTAATACCAACAGGTTTTCCTAATACGAATATAGAAACATCTTATGCATTTTTAGCATTAATATCTGCAATATTTGGGCCTTTTGCTGGTTTAATGACTGGATTAGTTGGACACGCTATTAAAGATTTCACGACATACGGTAGTGCTTGGTGGAGTTGGGTTATTTGTTCAGGAATTATAGGCTGTTTATATGGATGGATTGGCCTA------AAATTAAATCTTTCTTCAGGCCTATTTTCTAGGAAATCGATGATTTATTTTAATATCGGTCAAATTATTGCGAATATTATTTGCTGGGCACTTATTGCACCAACATTAGATATTTTGATTTATAACGAACCGGCTAACAAGGTTTATACACAAGGTGTTATCTCTGCAGTATTAAATATTATTTCAGTTGGTATTATTGGGACAATATTATTAAAAGCATATGCTTCATCTCAAATAAAAAAAGGTAGTTTACGTAAAGAA
TRN  10010101110011000
NAM  Q8XK19_CLOPE/5-184
ASQ  KLSIKTIVAIGIGSAVFMILGRFGSLPTGIPNTNIETAYAFLALMALLYGPLAGFLIGFIGHALKDIVFFGSPWISWVFASGIVGLIIGFGAR--FIKINQGVFKLKQIFMFNLIQIIANGVAWFLVAPTLDILIYSEPANKVYLQGVIGGISNMVTVGVLGTILIANYAKTRIQKGSLRKE
DSQ  AAACTATCAATTAAAACAATTGTAGCTATAGGAATTGGCTCAGCAGTTTTTATGATATTAGGTAGATTTGGTTCTTTGCCTACAGGAATTCCTAATACAAACATAGAAACAGCATATGCGTTTTTAGCTTTAATGGCATTGTTATATGGTCCTTTAGCTGGTTTTTTAATAGGATTCATAGGACATGCTTTAAAAGATATAGTATTCTTTGGATCACCTTGGATAAGTTGGGTTTTTGCTTCAGGTATAGTAGGATTAATAATTGGATTTGGAGCTAGA------TTTATAAAAATTAATCAAGGAGTATTTAAGTTAAAGCAAATATTTATGTTTAATTTAATACAGATAATTGCCAATGGAGTGGCTTGGTTTTTAGTAGCACCAACTTTAGATATATTAATTTACTCTGAACCTGCAAATAAGGTTTATCTACAAGGGGTAATTGGTGGAATTTCTAATATGGTTACTGTTGGAGTTTTAGGAACTATTTTAATAGCTAATTATGCTAAGACAAGAATACAAAAAGGTAGCTTAAGAAAAGAA
TRN  10010101110011000
NAM  Q88ZZ1_LACPL/6-185
ASQ  SNSIRTVVATGIGAAVIFVLMKFVAIPTGVPNTQVNVAMGFLALLGAIFGPVAAGLAVFIGHALNDFVTYGSPWWTWVIVDGLIGVAFGLAKN--RLKIENGVLGTAKLVWFNIYQIIVNFIGWVLLAPTGDIIIYHEPANKVYLQGVITWIADSISVAIIGTILLVLYARTRTQRGSLTKE
DSQ  TCCAATTCAATTCGTACCGTCGTGGCTACCGGGATCGGCGCCGCCGTTATTTTTGTTCTCATGAAATTTGTCGCCATTCCAACGGGTGTGCCGAATACCCAGGTTAACGTCGCGATGGGGTTTTTAGCCTTACTAGGTGCCATCTTTGGTCCCGTTGCAGCTGGTTTAGCCGTGTTCATCGGTCACGCCTTAAACGACTTCGTAACTTATGGTTCGCCTTGGTGGACCTGGGTCATCGTTGATGGTCTGATTGGGGTTGCCTTCGGACTAGCTAAAAAT------CGGCTCAAGATTGAAAATGGCGTGCTAGGAACGGCAAAATTAGTCTGGTTTAACATTTACCAAATCATCGTCAACTTTATTGGTTGGGTGCTTTTAGCACCAACTGGTGATATTATTATTTATCATGAACCGGCCAACAAAGTTTACCTTCAAGGTGTCATTACTTGGATCGCCGATTCCATCTCAGTTGCCATCATTGGGACCATCCTACTAGTCTTATACGCCCGGACGCGGACCCAACGTGGGAGCTTAACAAAGGAA
TRN  11011101101011000
NAM  Q87G36_VIBPA/2-182
ASQ  NLSAKTVVVIAIGAALYGIGGLPMFGIPVFANTTLKPAMAVLALFSVLFGPLVGFLVGFIGHWVTDLFAGWGVWLTWVLGSGIVGLIIGLFPSLTRYRLEKGDFNMKDFALFVVLALLGNVFGYGC-SAFLDTILYAEPFTKVFTQLSIIAIGNTILIAIVGFFILKSVAKRNKQSRNLTEA
DSQ  AATCTTTCTGCTAAAACCGTTGTGGTTATTGCAATTGGTGCTGCTCTTTACGGCATCGGTGGCTTACCTATGTTTGGCATCCCTGTGTTTGCGAACACAACGCTAAAACCAGCAATGGCAGTATTAGCATTGTTCTCAGTACTATTTGGCCCACTTGTTGGCTTTTTGGTTGGTTTTATTGGCCACTGGGTCACCGACCTATTTGCAGGTTGGGGCGTATGGCTCACTTGGGTACTTGGTTCAGGTATTGTTGGTTTGATTATCGGTCTATTCCCTTCTCTAACGCGCTACCGTTTGGAGAAAGGTGATTTCAATATGAAAGACTTCGCGTTATTCGTGGTACTTGCACTATTAGGCAACGTATTTGGTTACGGTTGC---TCTGCATTCCTCGACACGATTTTGTACGCTGAACCGTTTACTAAAGTGTTTACCCAGCTTTCTATTATCGCGATCGGTAACACCATTCTTATTGCTATTGTTGGCTTCTTCATTCTTAAGTCTGTCGCTAAACGTAACAAGCAAAGCCGTAACTTAACAGAGGCT
TRN  11011101111011000
//