EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07137 - VDE)
FAM  PF07137
PID  VDE
DES  Violaxanthin de-epoxidase (VDE)
IPR  IPR010788
ANO  3
ALN  354
AID  0.790932
APH  (Q945R7_ORYSA/94-446:0.14005,Q9SM43_SPIOL/120-472:0.12404,Q39249_ARATH/109-462:0.11501);
ATP  (Q945R7_ORYSA/94-446,Q9SM43_SPIOL/120-472,Q39249_ARATH/109-462);
ATL  0.3791
DNO  3
DLN  1062
DID  0.715455
DPH  (Q945R7_ORYSA/94-446:0.21664,Q9SM43_SPIOL/120-472:0.18692,Q39249_ARATH/109-462:0.15519);
DTP  (Q945R7_ORYSA/94-446,Q9SM43_SPIOL/120-472,Q39249_ARATH/109-462);
DTL  0.55875
RID  0.790932
RPH  (Q945R7_ORYSA/94-446:0.14005,Q9SM43_SPIOL/120-472:0.12404,Q39249_ARATH/109-462:0.11501);
RTP  (Q945R7_ORYSA/94-446,Q9SM43_SPIOL/120-472,Q39249_ARATH/109-462);
RTL  0.3791
LNK  Q39249_ARATH/109-462:Q39249:U44133
LNK  Q945R7_ORYSA/94-446:Q945R7:AF411133
LNK  Q9SM43_SPIOL/120-472:Q9SM43:AJ250433
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q945R7_ORYSA/94-446
ASQ  PSADAVDALKTCTCLLKECRIELAKCIANPSCAANVACLNTCNNRPDETECQIKCGDLFENTVVDEFNECAVSRKKCVPQKSDVGEFPVPDPSALVKNFNMADFNGKWYISSGLNPTFDTFDCQLHEFRVEGD-KLIANLTWRIRTPDSGFFTRTAIQRFVQDPAQPAILYNHDNEFLHYQDDWYIISSKVENKEDDYIFVYYRGRNDAWDGYGGAVLYTRSKVVPESIVPELERAAKSVGRDFSTFIRTDNTCGPEPPLVERIEKTVEQGEKTIIREVQEIEGEIEGEVKELEEEEVTLFKRLTDGLMEVKQDLMNFFQGLSKEEMELLDQMNMEATEVEKVFSRALPIRKLR
DSQ  CCTTCTGCCGATGCTGTGGATGCTCTCAAGACATGCACTTGCCTTCTCAAGGAGTGCAGAATAGAGCTGGCCAAATGCATAGCAAACCCATCCTGTGCAGCGAATGTAGCATGCTTAAATACATGCAACAATCGCCCTGACGAGACTGAATGCCAGATCAAATGTGGAGATCTGTTTGAGAACACTGTGGTCGATGAGTTCAACGAGTGTGCTGTTTCGCGCAAGAAATGCGTCCCACAAAAGTCCGACGTTGGCGAGTTCCCAGTCCCTGATCCATCCGCCCTTGTCAAGAACTTCAACATGGCTGATTTCAACGGCAAGTGGTATATTTCAAGTGGCCTCAATCCCACTTTCGACACATTCGATTGCCAACTTCACGAGTTCCGTGTCGAGGGAGAC---AAACTTATAGCGAACTTGACATGGAGAATTCGCACCCCCGACTCTGGCTTCTTCACCAGAACAGCCATACAGCGGTTTGTGCAGGACCCAGCACAACCCGCGATCCTCTATAACCATGACAACGAGTTCCTGCACTATCAAGATGACTGGTACATTATCTCATCCAAAGTAGAGAACAAGGAAGATGACTACATTTTCGTGTACTACCGCGGCAGAAATGATGCGTGGGATGGATATGGAGGTGCTGTTCTGTACACCAGAAGCAAAGTTGTGCCTGAATCAATAGTACCTGAGCTAGAAAGGGCGGCAAAAAGCGTAGGTCGTGACTTCTCCACATTCATCAGAACCGACAACACCTGCGGTCCTGAGCCACCTCTTGTGGAGAGAATAGAGAAGACCGTCGAGCAAGGAGAGAAGACCATCATCAGGGAAGTGCAGGAGATCGAGGGCGAGATCGAGGGAGAGGTGAAGGAGCTGGAGGAGGAGGAGGTCACATTGTTCAAGAGGTTGACAGATGGCCTCATGGAGGTGAAACAGGACTTGATGAACTTCTTTCAGGGGCTAAGCAAGGAGGAGATGGAGCTTTTGGATCAGATGAACATGGAAGCAACTGAGGTTGAGAAGGTCTTCAGCCGCGCCCTGCCAATAAGGAAACTAAGG
TRN  10010101100011000
NAM  Q9SM43_SPIOL/120-472
ASQ  SSAQAVDALKTCTCLLKECRIELAKCIANPSCAANVACLQTCNNRPDETECQIKCGDLFANKVVDEFNECAVSRKKCVPQKSDVGEFPVPDPSVLVKSFNMADFNGKWFISSGLNPTFDAFDCQLHEFHLEDG-KLVGNLSWRIKTPDGGFFTRTAVQKFAQDPSQPGMLYNHDNAYLHYQDDWYILSSKIENQPDDYVFVYYRGRNDAWDGYGGAFLYTRSATVPENIVPELNRAAQSVGKDFNKFIRTDNTCGPEPPLVERLEKTVEEGERTIIKEVEQLEGEIEGDLEKVGKTEMTLFQRLLEGFQELQKDEEYFLKELNKEERELLEDLKMEAGEVEKLFGRALPIRKLR
DSQ  TCTTCGGCACAAGCTGTTGATGCTCTTAAAACTTGTACCTGTTTGCTGAAGGAATGCAGAATTGAACTCGCCAAGTGCATCGCAAATCCATCTTGTGCAGCCAATGTTGCTTGCCTGCAGACCTGCAATAATAGACCTGATGAAACCGAATGCCAAATCAAATGTGGGGACTTGTTCGCCAACAAAGTTGTTGACGAGTTCAACGAGTGTGCAGTCTCTCGAAAGAAATGCGTGCCTCAGAAGTCTGATGTTGGAGAATTTCCTGTTCCCGATCCTAGTGTGCTCGTTAAGAGTTTCAACATGGCAGATTTCAACGGGAAGTGGTTTATAAGTAGTGGTCTAAACCCTACATTCGACGCTTTTGATTGCCAGTTACATGAGTTCCATTTGGAAGATGGA---AAACTTGTTGGAAACTTGTCTTGGCGAATAAAAACACCAGATGGTGGTTTTTTCACACGCACTGCTGTACAGAAATTTGCGCAAGACCCCTCTCAACCTGGAATGCTGTATAATCATGACAATGCATATCTTCACTATCAAGATGATTGGTACATCCTATCTTCTAAAATTGAAAATCAACCAGATGACTACGTATTTGTATATTACCGAGGCAGGAATGATGCGTGGGATGGCTATGGTGGCGCATTTCTTTACACAAGAAGTGCAACTGTACCTGAAAATATCGTGCCTGAACTTAACAGAGCAGCTCAAAGTGTAGGAAAAGACTTCAATAAATTCATCCGAACGGACAATACCTGTGGGCCCGAGCCTCCACTGGTTGAGAGGCTGGAGAAGACGGTGGAGGAAGGAGAAAGAACTATCATTAAGGAAGTAGAACAATTAGAAGGAGAGATAGAAGGAGACCTGGAAAAGGTTGGGAAAACTGAGATGACATTGTTTCAGAGGCTACTAGAAGGTTTTCAAGAGCTTCAAAAAGATGAAGAATACTTCCTCAAAGAATTAAACAAGGAAGAGCGAGAATTACTGGAAGACTTAAAGATGGAGGCTGGCGAGGTGGAAAAACTATTTGGGCGGGCATTACCTATAAGAAAGCTTCGG
TRN  10010101100011010
NAM  Q39249_ARATH/109-462
ASQ  PSADAVDALKTCACLLKGCRIELAKCIANPACAANVACLQTCNNRPDETECQIKCGDLFENSVVDEFNECAVSRKKCVPRKSDLGEFPAPDPSVLVQNFNISDFNGKWYITSGLNPTFDAFDCQLHEFHTEGDNKLVGNISWRIKTLDSGFFTRSAVQKFVQDPNQPGVLYNHDNEYLHYQDDWYILSSKIENKPEDYIFVYYRGRNDAWDGYGGAVVYTRSSVLPNSIIPELEKAAKSIGRDFSTFIRTDNTCGPEPALVERIEKTVEEGERIIVKEVEEIEEEVEKEVEKVGRTEMTLFQRLAEGFNELKQDEENFVRELSKEEMEFLDEIKMEASEVEKLFGKALPIRKVR
DSQ  CCATCTGCAGATGCAGTTGATGCACTTAAAACTTGTGCATGCTTATTGAAGGGATGCAGGATAGAACTCGCAAAGTGCATTGCCAACCCTGCCTGTGCAGCCAATGTCGCGTGCCTTCAGACCTGCAATAACCGTCCAGATGAAACCGAGTGCCAGATTAAATGTGGGGATCTGTTTGAGAACAGTGTTGTTGATGAGTTCAACGAGTGTGCTGTGTCGAGAAAAAAGTGTGTTCCTAGAAAATCTGATCTCGGAGAATTTCCTGCCCCAGACCCTTCTGTTCTTGTACAGAACTTCAACATCTCGGACTTTAACGGGAAGTGGTACATTACAAGTGGCTTGAATCCAACCTTTGATGCCTTCGACTGCCAGCTGCATGAGTTCCACACAGAAGGTGACAACAAGCTTGTTGGAAACATCTCTTGGAGAATAAAGACCCTAGACAGTGGATTCTTTACTAGGTCAGCCGTACAAAAATTCGTGCAAGATCCTAACCAACCTGGTGTTCTCTACAATCATGACAACGAGTACCTTCACTATCAAGATGACTGGTATATCCTGTCATCAAAGATAGAGAATAAACCTGAAGACTATATATTTGTATACTACCGTGGGCGAAACGATGCTTGGGATGGATATGGTGGTGCAGTTGTATACACGAGAAGTTCTGTATTACCCAATAGCATTATACCAGAACTCGAAAAAGCAGCAAAAAGCATAGGCAGAGACTTCAGCACATTCATTAGAACGGATAACACATGTGGTCCTGAACCTGCGCTCGTGGAGAGAATTGAGAAGACAGTGGAAGAAGGTGAAAGGATAATCGTAAAAGAGGTTGAAGAGATAGAAGAAGAGGTAGAGAAGGAAGTGGAGAAGGTCGGTAGGACTGAGATGACCTTGTTCCAGAGATTGGCTGAAGGATTTAATGAACTGAAGCAAGACGAGGAGAATTTCGTGAGAGAGTTAAGTAAAGAAGAGATGGAGTTTTTGGATGAGATCAAAATGGAAGCAAGTGAGGTTGAAAAATTGTTTGGGAAAGCTTTGCCAATCAGGAAGGTCAGG
TRN  10010101100011000
//