EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07082 - DUF1350)
FAM  PF07082
PID  DUF1350
DES  Protein of unknown function (DUF1350)
IPR  IPR010765
ANO  3
ALN  271
AID  0.574775
APH  (P73194_SYNY3/2-272:0.30331,Q8YXX2_ANASP/2-251:0.31391,Q8DG48_SYNEL/2-249:0.43057);
ATP  (P73194_SYNY3/2-272,Q8YXX2_ANASP/2-251,Q8DG48_SYNEL/2-249);
ATL  1.04779
DNO  3
DLN  813
DID  0.573638
DPH  (P73194_SYNY3/2-272:0.31894,Q8YXX2_ANASP/2-251:0.26537,Q8DG48_SYNEL/2-249:0.40524);
DTP  (P73194_SYNY3/2-272,Q8YXX2_ANASP/2-251,Q8DG48_SYNEL/2-249);
DTL  0.98955
RID  0.574775
RPH  (P73194_SYNY3/2-272:0.30331,Q8YXX2_ANASP/2-251:0.31391,Q8DG48_SYNEL/2-249:0.43057);
RTP  (P73194_SYNY3/2-272,Q8YXX2_ANASP/2-251,Q8DG48_SYNEL/2-249);
RTL  1.04779
LNK  P73194_SYNY3/2-272:P73194:BA000022
LNK  Q8DG48_SYNEL/2-249:Q8DG48:BA000039
LNK  Q8YXX2_ANASP/2-251:Q8YXX2:BA000019
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  P73194_SYNY3/2-272
ASQ  EWREISGSWVLVPPQPIAVVHFLGGAFVGTAPNVAYRWLLTELGKAGYVVVATPFVNTFDHQAIARSVLNRFEIILERLQKQGEITTGLLPVYGLGHSLGCKLHLLIGSLYEVERAGNILVAFNNYPVKQAIPFGEQLAQLQLDKFLTGVQKQLRQLNLQVDLNFEFTPSPEETNLLIAENYRVRRNLLIKFSNDDIDQTLGLRPILNQQTADLVAYCPLPGNHLTPLGQDIQWETGQEFSPLDAVGQWLKNSLSQDLRRLQKEILRWLEP
DSQ  GAATGGCGTGAAATTTCTGGCAGTTGGGTTCTAGTGCCGCCCCAACCGATCGCCGTGGTGCATTTTCTCGGGGGAGCTTTTGTCGGTACGGCCCCCAATGTGGCCTATCGTTGGTTACTAACGGAATTAGGTAAAGCTGGTTATGTGGTGGTGGCCACCCCCTTCGTCAACACCTTCGACCACCAGGCGATCGCCCGTAGTGTGCTGAATCGCTTTGAAATTATTCTGGAAAGATTGCAAAAACAAGGGGAAATTACCACTGGTTTACTGCCGGTATACGGCTTAGGCCATAGCTTGGGTTGTAAACTACATCTACTCATTGGCAGTTTGTACGAGGTGGAGCGGGCCGGCAATATCCTCGTTGCGTTTAATAACTATCCCGTTAAACAGGCTATTCCCTTTGGGGAACAATTAGCCCAACTGCAACTGGATAAATTCCTCACAGGGGTGCAAAAACAATTAAGACAGCTCAATCTCCAGGTGGATTTAAATTTTGAATTTACTCCATCCCCGGAGGAAACCAACCTTTTAATCGCCGAAAATTATCGAGTGCGGCGTAATTTATTAATTAAATTTTCCAACGATGATATTGACCAAACCCTGGGCTTAAGGCCAATTTTAAATCAACAAACCGCTGACCTAGTGGCCTACTGTCCCCTACCTGGCAATCATTTGACTCCTTTGGGGCAAGACATTCAATGGGAAACCGGCCAGGAATTTTCCCCCTTAGACGCAGTGGGGCAATGGTTGAAAAATTCCCTTTCCCAGGATTTGAGGCGACTGCAAAAGGAAATTCTCCGTTGGCTAGAACCG
TRN  10010101100011010
NAM  Q8YXX2_ANASP/2-251
ASQ  DWKEIRGNWVLVPRNPVGIIHFLGGAFVATAPHLTYRWLLEQLGNKGYVVIATPFVNTLDHIAIANSVLLNFERTIERLHDSGALRKLYLPTYGIGHSMGCKLHLLIGSLFPVERAGNILISFNNYAAKDAIPL--------VEQFNTTL-------------AIEFTPSPLETNKLVQESYNVRRNLLIKFNNDNLDQSAALTKILQVRFPEMVTAQTLPGTHTTPLGQDVKWQTGSSFTPFDALGQWFKQEVYRDLNQLNRAMLLWLNP
DSQ  GATTGGAAAGAAATTAGAGGTAACTGGGTGCTTGTTCCCCGTAATCCAGTCGGGATCATTCATTTCTTGGGAGGTGCGTTTGTTGCCACAGCACCCCATCTGACATATCGTTGGCTACTGGAACAGTTGGGTAATAAAGGGTATGTAGTGATTGCCACGCCCTTTGTGAATACATTGGATCATATTGCGATCGCCAACTCTGTGCTATTGAACTTTGAACGCACGATAGAAAGATTGCATGATTCTGGGGCATTACGCAAGCTCTACTTACCTACCTACGGAATCGGACATAGTATGGGGTGTAAACTCCATCTACTCATTGGCAGTCTTTTTCCTGTGGAACGAGCAGGCAATATTTTAATCTCTTTCAACAACTATGCTGCTAAGGATGCTATACCCTTA------------------------GTGGAACAGTTCAACACTACTTTG---------------------------------------GCGATTGAATTTACTCCCTCGCCTTTGGAAACAAACAAACTCGTACAGGAAAGTTATAATGTCCGGCGCAACTTATTAATCAAATTTAATAACGATAACCTGGATCAATCAGCAGCTTTAACCAAAATCTTACAAGTCCGCTTTCCAGAAATGGTGACAGCCCAGACTTTACCAGGAACGCACACCACACCCTTAGGTCAAGATGTCAAATGGCAAACAGGATCATCATTCACCCCCTTTGATGCGTTAGGGCAGTGGTTCAAACAAGAAGTCTATCGTGACTTAAATCAGCTAAACCGTGCCATGCTCTTGTGGTTAAATCCT
TRN  10010101100011000
NAM  Q8DG48_SYNEL/2-249
ASQ  EWQEVRGNWLCIPQRPLGWIHFLGGAFVAAAPQLTYRRLLEHLAEANYGIIATPFVNSFDHGAIALDALNKLDYALDWLVHRQGYPPA-LPIYGLGHSMGCKLHLLINSLYDGDRAGNMFMAFNNYPASQSIPW--------MDNLGPA--------------SVEFTPSPTETEHFIQKRYPVRRNLLIRFQDDDIDQTARLRSLLRAKFGDMVTALKLPGNHLTPLSQDLKWQVGAEFSPLDALGQWIKQSLFPEMPVLEACLLEWLNP
DSQ  GAGTGGCAAGAGGTTCGCGGCAACTGGCTGTGTATTCCCCAGCGCCCCTTGGGGTGGATTCACTTTCTAGGGGGAGCCTTTGTGGCAGCGGCACCGCAGTTGACCTATCGGCGCCTGTTGGAGCACCTAGCGGAGGCAAACTATGGCATTATTGCCACACCCTTTGTGAATAGCTTTGATCATGGGGCGATCGCCCTCGATGCCCTCAATAAACTCGACTATGCCCTTGATTGGCTGGTACACCGCCAAGGCTACCCGCCAGCA---CTGCCCATCTATGGTCTAGGGCACAGTATGGGCTGCAAATTGCACCTGCTGATCAATAGTCTTTACGATGGCGATCGGGCTGGGAATATGTTCATGGCCTTCAACAACTACCCCGCCAGTCAATCCATTCCTTGG------------------------ATGGACAACCTGGGCCCCGCC------------------------------------------AGTGTTGAATTCACCCCCAGCCCAACCGAAACCGAACACTTCATTCAAAAGCGCTATCCCGTGCGCCGCAACCTCCTGATTCGCTTCCAGGATGACGACATTGACCAAACGGCGCGGCTGCGCAGTCTCCTCAGAGCCAAATTTGGCGATATGGTCACTGCCCTCAAGCTACCGGGGAATCACCTCACCCCCCTTAGCCAAGACCTCAAGTGGCAAGTTGGCGCAGAATTTTCTCCCTTGGATGCCCTCGGCCAGTGGATCAAGCAAAGTCTCTTTCCCGAAATGCCAGTTCTTGAGGCCTGCCTATTGGAGTGGCTCAATCCC
TRN  10010101100011011
//