EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07074 - TRAP-gamma)
FAM  PF07074
PID  TRAP-gamma
DES  Translocon-associated protein, gamma subunit (TRAP-gamma)
IPR  IPR009779
ANO  3
ALN  172
AID  0.494042
APH  (Q9VL69_DROME/17-186:0.24338,SSRG_RAT/12-183:0.20460,Q95XS1_CAEEL/7-176:0.80643);
ATP  (Q9VL69_DROME/17-186,SSRG_RAT/12-183,Q95XS1_CAEEL/7-176);
ATL  1.25441
DNO  3
DLN  516
DID  0.571895
DPH  (Q9VL69_DROME/17-186:0.18023,SSRG_RAT/12-183:0.29762,Q95XS1_CAEEL/7-176:0.51432);
DTP  (Q9VL69_DROME/17-186,SSRG_RAT/12-183,Q95XS1_CAEEL/7-176);
DTL  0.99217
RID  0.494042
RPH  (Q9VL69_DROME/17-186:0.24338,SSRG_RAT/12-183:0.20460,Q95XS1_CAEEL/7-176:0.80643);
RTP  (Q9VL69_DROME/17-186,SSRG_RAT/12-183,Q95XS1_CAEEL/7-176);
RTL  1.25441
LNK  Q95XS1_CAEEL/7-176:Q95XS1:AC025715
LNK  Q9VL69_DROME/17-186:Q9VL69:AE003626
LNK  SSRG_RAT/12-183:Q08013:Z14030
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9VL69_DROME/17-186
ASQ  EEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIWLFWRIHNMDLWPSSILFVLVTAASTYLMATAYKNIKFQLKHKIAGRREEAVTREVNRQV--GDDKKVTRKEKDERILWKKNEVADYEATTFSIFYNNAIYLAVIIFISFFILKNSTPFINYIFSVGIASGALSLFSTS
DSQ  GAAGAGGAGCTGCTGCTGCAGGACTTTAGCCGCAACGTGAGCACCAAGTCGTCGGCGCTGTTCTACGGCAATGCCTTTATCGTGTCGGCCGTTCCAATCTGGCTCTTCTGGCGCATCCACAACATGGACTTGTGGCCCAGCTCCATCCTGTTCGTCCTGGTGACGGCCGCTAGTACTTATCTGATGGCCACCGCCTACAAGAACATCAAGTTCCAGCTGAAGCACAAGATCGCCGGACGGCGGGAGGAGGCGGTGACCCGCGAGGTCAACCGTCAGGTG------GGCGATGACAAGAAGGTCACGCGCAAGGAAAAGGACGAGCGCATCCTGTGGAAGAAGAACGAGGTAGCCGACTACGAGGCCACCACCTTCTCCATCTTCTACAACAACGCCATCTACCTGGCCGTTATCATTTTCATCAGCTTCTTTATCCTGAAGAACTCGACGCCGTTCATCAACTACATCTTTTCCGTGGGCATCGCCAGCGGCGCTCTGTCGCTCTTCTCCACCAGC
TRN  11011111101111111
NAM  SSRG_RAT/12-183
ASQ  EEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPRVNYILSISASSGLIALLSTG
DSQ  GAGGAGGACCTGCTCCTTCAGGATTTCAGCCGCAACCTGTCCGCCAAATCGTCGGCGCTGTTCTTCGGGAATGCGTTCATCGTGTCTGCCATTCCCATCTGGTTGTACTGGAGAATATGGCATATGGATCTTATCCAGTCTGCTGTTCTGTACAGCGTGATGACGTTAGTAAGCACTTACTTGGTAGCCTTTGCATACAAGAATGTAAAATTTGTTCTCAAGCACAAAGTAGCACAGAAGAGGGAAGATGCTGTTTCCAAAGAAGTGACCCGCAAACTTTCTGAAGCTGATAATAGAAAGATGTCCCGGAAGGAGAAAGATGAAAGAATCCTGTGGAAGAAGAATGAAGTTGCCGATTATGAAGCTACAACATTCTCCATCTTCTATAACAACACTCTGTTCCTGGTTCTGGTTATTGTTGCCTCCTTCTTTATACTGAAGAACTTCAACCCCAGAGTGAACTACATTCTGTCCATAAGTGCTTCATCTGGACTCATCGCCCTCTTGTCTACTGGC
TRN  10010101100011000
NAM  Q95XS1_CAEEL/7-176
ASQ  EEELLLSSYSATSSTKGNLFFYLNALIISIAPLYLFYGVHQMEIQDSLVVWGLSAVGTAYLLSLACKNQKCLLKHQIVMKRGSAVEREISGQY--AADKKMTVKEKEERALFRKNEVADTESTYLSVFYTNSLYLTIMLVSAFFLLANVAPVFNLLISTIGSAGLVAFLSTA
DSQ  GAAGAGGAACTTCTGCTCTCGAGCTACTCGGCGACCAGCTCCACCAAGGGAAACCTCTTCTTCTACCTCAACGCGTTGATCATCTCCATCGCCCCGCTCTACCTCTTCTACGGAGTTCACCAGATGGAGATCCAAGACTCGCTTGTCGTGTGGGGACTCTCTGCCGTCGGCACTGCCTACCTCCTGTCCCTGGCCTGCAAAAACCAGAAGTGCCTTCTCAAGCATCAAATCGTGATGAAGCGCGGATCAGCTGTGGAACGCGAGATCAGCGGACAATAT------GCTGCTGACAAGAAAATGACTGTTAAGGAGAAGGAGGAGCGCGCGCTTTTCCGCAAAAACGAGGTCGCCGACACCGAATCCACCTACTTGTCGGTCTTCTACACAAACTCGCTCTACTTGACCATCATGCTCGTCTCGGCGTTCTTCTTGCTCGCCAACGTGGCTCCAGTCTTCAACTTGCTCATCTCCACCATCGGATCCGCCGGACTCGTCGCCTTCCTCTCCACCGCT
TRN  11011101101011001
//