EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07068 - Gp23)
FAM  PF07068
PID  Gp23
DES  Major capsid protein Gp23
IPR  IPR010762
ANO  4
ALN  502
AID  0.778207
APH  (Q9MCE3_BPR69/10-502:0.01417,COAT_BPT4/9-501:0.05073,(O64375_9VIRU/3-495:0.51587,Q38056_BPS14/10-502:0.02848):0.03350);
ATP  (Q9MCE3_BPR69/10-502,COAT_BPT4/9-501,(O64375_9VIRU/3-495,Q38056_BPS14/10-502));
ATL  0.64275
DNO  2
DLN  1506
DID  0.64657
DPH  (COAT_BPT4/9-501:0.29344,O64375_9VIRU/3-495:0.18925);
DTP  (COAT_BPT4/9-501,O64375_9VIRU/3-495);
DTL  0.48269
RID  0.631696
RPH  (COAT_BPT4/9-501:0.51221,O64375_9VIRU/3-495:0.02559);
RTP  (COAT_BPT4/9-501,O64375_9VIRU/3-495);
RTL  0.5378
LNK  COAT_BPT4/9-501:P04535:X01774
LNK  O64375_9VIRU/3-495:O64375:D83517
LNK  Q38056_BPS14/10-502:Q38056:
LNK  Q9MCE3_BPR69/10-502:Q9MCE3:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9MCE3_BPR69/10-502
ASQ  LVDKWKELLEGEG--LPEIAN-SKQAIIAKIFENQEKDFEVSPEYKDDKIAQAFGSFLTEAEIGGDHGY.AQNIAAGQTSGAVTQIGPAV.GMVRRAIPNLIAFDICGVQPMNSPTGQVFALRAVYGKDPIAAGAKEAFHPMYAPDAMFSGQGAA-KKFPALAASTQTKVGDIYT-HFFQETGTVY---LQASAQVTISSSADDAAKLDAEIIKQMEAGALVEIAEGMATSIAELQEGFNGSTDNPWNEMGFRIDKQVIEAKSRQLKAAYSIELAQDLRAVHGMDADAELSGILATEIMLEINREVVDWINYSAQVGKSGMSNIVGSKAGVFDFQDPIDIRGVRWAGESFKALLFQIDKEAVEIARQTGRGEGNFIIA.RNVVNVLASVDTGISYAAQGLASG-FPTDTTKSVFAGVLGGKYRVYIDQYAKQDYFTVGYKGANEMDAGIYYAPYVALTPLRGSDPKNFQPVMGFKTRYGIGVNPFAESSLQAPGARIQSGMP
NAM  COAT_BPT4/9-501
ASQ  LLNKWKPLLEGEG--LPEIAN-SKQAIIAKIFENQEKDFQTAPEYKDEKIAQAFGSFLTEAEIGGDHGYnATNIAAGQTSGAVTQIGPAVmGMVRRAIPNLIAFDICGVQPMNSPTGQVFALRAVYGKDPVAAGAKEAFHPMYGPDAMFSGQGAA-KKFPALAASTQTTVGDIYT-HFFQETGTVY---LQASVQVTIDAGATDAAKLDAEIKKQMEAGALVEIAEGMATSIAELQEGFNGSTDNPWNEMGFRIDKQVIEAKSRQLKAAYSIELAQDLRAVHGMDADAELSGILATEIMLEINREVVDWINYSAQVGKSGMTLTPGSKAGVFDFQDPIDIRGARWAGESFKALLFQIDKEAVEIARQTGRGEGNFIIAsRNVVNVLASVDTGISYAAQGLATG-FSTDTTKSVFAGVLGGKYRVYIDQYAKQDYFTVGYKGPNEMDAGIYYAPYVALTPLRGSDPKNFQPVMGFKTRYGIGINPFAESAAQAPASRIQSGMP
DSQ  CTTTTGAACAAATGGAAGCCATTACTGGAAGGTGAAGGT------TTACCGGAAATTGCTAAT---AGCAAACAAGCGATTATCGCTAAAATCTTTGAAAACCAGGAAAAAGATTTCCAGACAGCTCCGGAATATAAAGACGAAAAAATTGCTCAGGCATTCGGTTCTTTCTTAACAGAAGCTGAAATCGGTGGTGACCACGGTTACaatGCTACCAACATCGCTGCAGGTCAGACTTCTGGCGCAGTAACTCAGATTGGCCCAGCTGTTatgGGTATGGTACGTCGTGCTATTCCTAACCTGATTGCTTTCGATATTTGTGGTGTTCAGCCGATGAACAGCCCGACTGGCCAGGTATTCGCACTGCGCGCAGTATATGGTAAAGACCCAGTGGCTGCCGGTGCTAAAGAAGCATTCCACCCAATGTATGGTCCAGATGCAATGTTCTCTGGTCAGGGTGCTGCT---AAGAAATTCCCAGCTCTGGCTGCTAGCACACAAACCACAGTAGGTGATATCTATACT---CACTTCTTCCAGGAAACTGGTACTGTATAT---------CTGCAAGCTTCTGTTCAAGTAACAATCGATGCTGGTGCGACTGATGCTGCTAAATTAGATGCTGAAATTAAGAAACAAATGGAAGCTGGTGCACTGGTAGAAATCGCTGAAGGTATGGCTACTTCTATCGCTGAACTCCAGGAAGGTTTCAATGGTTCTACCGATAACCCATGGAATGAAATGGGCTTCCGTATCGATAAGCAAGTTATCGAAGCTAAATCTCGTCAGCTGAAAGCTGCTTACTCTATTGAATTAGCACAAGACCTCCGCGCTGTTCACGGTATGGATGCTGATGCTGAACTGTCTGGTATTCTGGCTACAGAAATTATGCTGGAAATCAACCGTGAAGTTGTTGATTGGATTAACTACTCAGCTCAGGTTGGTAAATCTGGTATGACCCTGACTCCGGGTTCTAAAGCTGGTGTATTTGACTTCCAGGACCCAATTGATATTCGTGGTGCTCGCTGGGCGGGTGAATCCTTTAAAGCTCTGTTGTTCCAGATTGACAAAGAAGCAGTTGAAATTGCTCGTCAGACCGGTCGTGGTGAAGGTAACTTCATTATCGCTtccCGTAACGTAGTTAACGTTTTGGCTTCAGTTGATACCGGCATTTCTTATGCTGCACAGGGTCTGGCTACCGGC---TTTAGCACTGATACTACCAAGTCAGTATTTGCTGGTGTTCTGGGTGGTAAATACCGCGTATATATCGACCAGTATGCTAAACAGGATTATTTCACTGTAGGTTATAAAGGTCCGAACGAAATGGATGCTGGTATTTACTATGCTCCATATGTAGCTCTGACTCCGCTGCGTGGTTCCGATCCGAAGAACTTCCAACCGGTAATGGGATTCAAAACTCGTTACGGTATCGGTATCAACCCATTTGCAGAATCCGCTGCTCAGGCTCCGGCTTCTCGCATCCAGAGCGGTATGCCT
TRN  11011101101011000
NAM  Q38056_BPS14/10-502
ASQ  LVDKWKELLEGEG--LPEIAN-SKQAIIAKIFENQEKDFEVSPEYKDEKIAQAFGSFLTEAEIGGDHGYnAQNIAAGQTSGAVTQIGRSVmGMVRRAIPNLIAFDICGVQPMNSPTGQVFALRAVYGKDPIAADAKEAFHPMYAPDAMFSGQGAA-KAFTPVTAGMATVAGDIYY-HFFAETGSTY---LQATKVVTISAEASTPELMDAEIIKQMEAGVLVEIAEGMATSIAELQEGFNGSTDNPWNEMGFRIDKQVIEAKSRQLKAAYSIELAQDLRAVHGMDADAELSGILATEIMLEINREVVDWINYSAQVGKSGMTNIVGSKAGVFDFQDPIDIRGARWAGESFKALLFQIDKEAVEIARQTGRGEGNFIIAsRNVVNVLASVDTGISYAAQGLASG-FNTDTTKSVFAGVLGGKYRVYIDQYAKQDYFTVGYKGANEMDAGIYYAPYVALXPLRGSDPKNFQPVMGFKTRYGIGVNPFAESSLQAPGARIQSGMP
NAM  O64375_9VIRU/3-495
ASQ  LTEKWKELLEADGAEMPEIATATKQKIMSKIFENQDRDINNDPMYRDPQLIEAFNAGLNEAVVNGDHGYdPSNIAQGVTTGAVTNIGPTVmGMVRRAIPQLIAFDIAGVQPMTGPTSQVFTLRSVYGKDPLTG--KEAFHPTRQADASFSGQAAAST-IADFPTTGAATDGTPYKAEVTT-SGG--DVDTRYFLALGAVTLAVAGEMTATEYTDAVAGGLLVEIDAGMATSQAELQENFNGSSNNEWNEMSFRIDKQVVEAKSRQLKAQYSIELAQDLRAVHGLDADAELSGILANEVMVELNREIVNLVNSQAQIGKSGWTQGQGA-AGVFDFADAVDVKGARWAGEAYKALLIQIEKEANEIGRQTGRGNGNFIIAsRNVVSALSMTDTLVGPAAQGMQDGSMNTDTNQTVFAGVLGGRFKVFIDQYAVNDYFTVGFKGSTEMDAGVFYSPYVPLTPLRGSDSKNFQPVIGFKTRYGIQVNPFADPTKSA--EKVGNGAP
DSQ  CTAACTGAAAAATGGAAAGAATTGCTTGAAGCAGACGGTGCGGAAATGCCAGAGATTGCGACTGCAACTAAGCAAAAAATCATGTCGAAAATCTTTGAAAACCAAGATCGCGACATCAACAACGATCCAATGTACCGTGACCCACAGCTAATCGAAGCATTCAATGCTGGTCTAAACGAAGCTGTAGTTAACGGTGACCATGGTTACgatCCGTCTAACATCGCTCAAGGTGTTACTACTGGTGCAGTAACAAACATCGGTCCAACTGTAatgGGTATGGTTCGTCGTGCTATTCCTCAGCTTATCGCATTCGATATCGCTGGTGTTCAGCCAATGACTGGCCCAACTAGCCAAGTATTCACACTTCGCTCAGTATACGGTAAAGACCCGCTAACTGGT------AAAGAAGCTTTCCACCCGACTCGTCAAGCTGACGCTTCGTTCTCTGGTCAAGCTGCTGCATCAACA---ATTGCAGATTTCCCAACTACTGGTGCTGCAACTGACGGTACTCCGTACAAAGCTGAAGTAACTACT---TCTGGTGGC------GACGTTGACACTCGTTACTTCCTAGCACTTGGCGCTGTTACTCTAGCAGTTGCAGGTGAAATGACTGCTACAGAATACACTGACGCAGTTGCAGGTGGTCTTCTAGTTGAGATCGACGCTGGTATGGCAACATCTCAGGCTGAACTACAAGAGAACTTCAACGGTTCAAGCAACAACGAGTGGAACGAGATGTCATTCCGCATCGACAAACAAGTTGTTGAAGCGAAATCACGTCAATTGAAAGCTCAATACTCAATCGAGCTTGCACAAGATCTACGTGCTGTACACGGTCTAGACGCTGACGCTGAACTTAGCGGTATTCTTGCTAACGAAGTTATGGTTGAGCTTAACCGCGAAATCGTTAACCTAGTTAACTCTCAAGCGCAAATCGGTAAGTCTGGTTGGACTCAAGGTCAAGGCGCA---GCGGGTGTATTCGACTTCGCAGACGCTGTAGACGTTAAAGGTGCTCGTTGGGCTGGTGAAGCTTACAAAGCTCTACTAATTCAAATTGAGAAAGAAGCGAACGAAATCGGTCGTCAAACTGGTCGTGGTAACGGTAACTTCATCATTGCAtcaCGCAACGTAGTTTCTGCACTATCAATGACTGATACTCTTGTTGGCCCTGCTGCACAAGGTATGCAAGACGGTTCAATGAACACTGACACAAACCAAACTGTGTTCGCGGGTGTTCTAGGTGGTCGCTTCAAAGTGTTCATCGACCAATACGCAGTGAACGATTACTTCACAGTTGGTTTCAAAGGTTCTACTGAAATGGACGCAGGTGTGTTCTACTCACCATACGTACCGCTGACTCCACTACGTGGTTCAGACAGCAAGAACTTCCAACCTGTAATTGGTTTCAAAACTCGTTACGGTATTCAAGTTAACCCATTCGCAGATCCTACTAAGTCTGCT------GAAAAAGTTGGTAACGGCGCGCCT
TRN  11011101101011001
//