EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07047 - OPA3)
FAM  PF07047
PID  OPA3
DES  Optic atrophy 3 protein (OPA3)
IPR  IPR010754
ANO  7
ALN  137
AID  0.409715
APH  (((((Q9M2K1_ARATH/4-136:0.33732,Q9SGP9_ARATH/4-136:0.20207):0.06874,Q8S2P6_ORYSA/72-205:0.13154):0.42661,Q8IKN8_PLAF7/3-137:1.17193):0.38583,OPA32_DROME/7-140:0.54035):0.38321,Q8C6Z9_MOUSE/7-139:0.11418,Q8N784_HUMAN/7-139:0.14903);
ATP  (((((Q9M2K1_ARATH/4-136,Q9SGP9_ARATH/4-136),Q8S2P6_ORYSA/72-205),Q8IKN8_PLAF7/3-137),OPA32_DROME/7-140),Q8C6Z9_MOUSE/7-139,Q8N784_HUMAN/7-139);
ATL  3.91079
DNO  6
DLN  411
DID  0.464625
DPH  (Q9SGP9_ARATH/4-136:0.22153,(Q9M2K1_ARATH/4-136:0.14689,((Q8C6Z9_MOUSE/7-139:0.10921,Q8N784_HUMAN/7-139:0.11316):0.32895,OPA32_DROME/7-140:0.26741):0.68171):0.08965,Q8IKN8_PLAF7/3-137:0.82377);
DTP  (Q9SGP9_ARATH/4-136,(Q9M2K1_ARATH/4-136,((Q8C6Z9_MOUSE/7-139,Q8N784_HUMAN/7-139),OPA32_DROME/7-140)),Q8IKN8_PLAF7/3-137);
DTL  2.78228
RID  0.387799
RPH  ((((Q9M2K1_ARATH/4-136:0.26263,Q9SGP9_ARATH/4-136:0.24922):0.38491,Q8IKN8_PLAF7/3-137:1.09277):0.46438,OPA32_DROME/7-140:0.51644):0.41070,Q8C6Z9_MOUSE/7-139:0.11275,Q8N784_HUMAN/7-139:0.14911);
RTP  ((((Q9M2K1_ARATH/4-136,Q9SGP9_ARATH/4-136),Q8IKN8_PLAF7/3-137),OPA32_DROME/7-140),Q8C6Z9_MOUSE/7-139,Q8N784_HUMAN/7-139);
RTL  3.6429
LNK  OPA32_DROME/7-140:Q9VCG3:AE003745
LNK  Q8C6Z9_MOUSE/7-139:Q8C6Z9:AK052774
LNK  Q8IKN8_PLAF7/3-137:Q8IKN8:AE014825
LNK  Q8N784_HUMAN/7-139:Q8N784:AK098798
LNK  Q8S2P6_ORYSA/72-205:Q8S2P6:
LNK  Q9M2K1_ARATH/4-136:Q9M2K1:AL137081
LNK  Q9SGP9_ARATH/4-136:Q9SGP9:AC010155
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  OPA32_DROME/7-140
ASQ  PAAKLGILAIKQVSKPIANVIKSNAKSSPFFRKYICMPPAQFYNWVEVKTKM--WALNMGGRVNVPPLNEAMAIELGANLLGEFIIFSIGAGLLIFEYSRQTIKENKKNELAQSEKM.ELTNMLTEMNFRLERQDAQ
DSQ  CCGGCGGCCAAGCTCGGCATTTTGGCCATCAAGCAGGTCAGCAAGCCGATAGCCAACGTGATTAAGTCCAATGCCAAATCGAGCCCCTTCTTCAGGAAGTACATATGCATGCCGCCCGCACAGTTCTACAACTGGGTAGAGGTGAAGACCAAGATG------TGGGCCCTGAACATGGGTGGTCGCGTTAATGTTCCACCGCTGAACGAGGCGATGGCCATTGAGCTGGGAGCCAATCTGCTTGGCGAGTTCATCATCTTCTCGATCGGAGCCGGTCTTTTGATTTTCGAGTACTCACGTCAAACCATCAAGGAGAACAAGAAAAACGAGTTGGCGCAATCGGAGAAGATG...GAACTAACCAATATGCTGACGGAGATGAACTTTCGGCTGGAGCGACAGGATGCCCAG
TRN  10010101100011001
NAM  Q8N784_HUMAN/7-139
ASQ  PMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWLEMRTKM--RIMGFNAAA-IKPLNEGAAAELGAELLGEGIIFITACSCLMLEYWRHQLQQRRKEKERRVARE.ALRGEVGHLELALEELQAQ
DSQ  CCTATGGCGAAGCTGCTATACTTGGGCATCCGGCAGGTCAGCAAGCCGCTTGCCAACCGTATTAAGGAGGCCGCCCGCCGAAGCGAGTTCTTCAAGACCTATATCTGCCTCCCGCCGGCTCAACTGTACCACTGGCTGGAGATGCGGACCAAAATG------CGCATCATGGGTTTCAATGCCGCTGCC---ATCAAGCCGCTGAACGAGGGTGCAGCCGCCGAGCTGGGCGCGGAGCTGCTGGGCGAGGGCATCATCTTCATCACCGCCTGCAGCTGCCTGATGCTGGAGTATTGGCGCCACCAGTTGCAGCAGCGCCGCAAGGAAAAGGAGCGACGTGTTGCCAGGGAG...GCGCTGCGGGGCGAGGTGGGCCACTTGGAGCTGGCGCTCGAGGAGTTGCAGGCGCAG
TRN  10010101100011011
NAM  Q8C6Z9_MOUSE/7-139
ASQ  PMAKLFYLGIRQVSKPLANRIKDAARRSEFFKTYICLPPAQLYHWVEMRAKM--RIMGFRGTT-IKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQTQQRNKEEEQRAAWN.ALQDEVGRLALALEALQAQ
DSQ  CCCATGGCGAAGCTGTTCTACTTGGGCATCCGGCAGGTTAGCAAGCCGCTGGCCAACCGTATCAAGGATGCTGCCCGCCGCAGCGAGTTCTTCAAGACCTACATCTGCCTACCGCCAGCCCAGCTGTACCACTGGGTGGAGATGCGGGCGAAGATG------CGCATAATGGGTTTCCGGGGCACTACC---ATCAAGCCACTGAATGAGGAGGCAGCAGCAGAGCTGGGTGCTGAGCTGCTGGGCGAGGCCACCATCTTCATTGTGGGCGGAGGCTGCCTGGTCCTGGAGTACTGGCGCCACCAGACTCAGCAGCGCAATAAGGAGGAGGAACAGCGGGCAGCCTGGAAC...GCTCTGCAGGATGAGGTGGGCCGCCTGGCACTGGCCTTAGAGGCGCTGCAGGCTCAG
TRN  10010111100111010
NAM  Q9SGP9_ARATH/4-136
ASQ  PLMKLGTLAVKTISKPLASQLKHQAKVHPKFRQSI-INFAQRNHRITTQMQR--RIYGHATDVEIRPLDEEKAVQAAVDLIGEIFLFGVGGAVVVFEVQRSSRSEARKEEARKQELE.ELRIKDEELEKQVADLKSK
DSQ  CCGTTGATGAAACTGGGCACACTCGCCGTCAAAACCATAAGTAAACCATTGGCTAGTCAGCTCAAGCACCAAGCTAAGGTTCATCCCAAGTTTCGTCAATCTATC---ATCAACTTCGCTCAGAGGAATCATCGAATCACTACGCAAATGCAAAGA------AGGATATATGGTCATGCCACTGATGTAGAGATTCGTCCCTTAGATGAGGAAAAGGCTGTTCAAGCTGCTGTTGACCTCATTGGAGAGATCTTTCTCTTTGGGGTCGGTGGAGCTGTTGTTGTTTTTGAGGTGCAGAGAAGTTCGCGGTCAGAAGCAAGAAAAGAGGAAGCACGTAAGCAAGAACTAGAG...GAGTTGAGAATAAAAGATGAAGAACTAGAAAAGCAAGTGGCAGATCTCAAGAGCAAG
TRN  10010101100011000
NAM  Q8S2P6_ORYSA/72-205
ASQ  PVAKLGTLALRTLSKPIASRLKNQAAVHPKFRNFI-ICIAQINHRVTTRIQR--RIYGHATDVEITPLNEEKAVQAATDLIGEGFIFSVAVAALIFEVQRNARSEARKEEARKQELEvELKQREESLSKDLEDLKLR
NAM  Q9M2K1_ARATH/4-136
ASQ  PLLKLGTLALRTICKPIANQLKKEAGVNPKFRQFI-INIAQANHRFTTKLQR--RASGRITDAVIRPLNEERAVQAAADLLGELFAFTVAGAALVYEVQRNARGEAKKEEKRQQELA.EFRRKHEKMENEIEEMKQR
DSQ  CCGCTTCTGAAGCTAGGAACCCTAGCTCTTCGAACTATCTGCAAACCCATCGCTAACCAGCTTAAGAAAGAAGCTGGTGTTAATCCCAAATTCCGTCAATTCATC---ATCAACATTGCACAGGCGAATCACAGATTTACTACAAAGTTACAAAGA------CGTGCTTCTGGTCGTATAACTGATGCAGTTATTCGCCCTTTGAACGAAGAGAGAGCTGTTCAAGCCGCTGCAGATCTTCTTGGGGAACTCTTTGCCTTCACGGTTGCAGGAGCTGCTCTTGTCTATGAAGTGCAGAGAAATGCCAGAGGAGAAGCGAAAAAAGAAGAGAAACGACAACAAGAACTAGCG...GAATTCAGACGTAAACATGAGAAGATGGAGAACGAAATCGAAGAGATGAAACAAAGA
TRN  10010101100011010
NAM  Q8IKN8_PLAF7/3-137
ASQ  PLFKIGIVLIRQVSKPISGYIKKKAIDNKNFKSIC-IYCGKKYYFFEQYIQKKFYNSNTTNINYSSYISENKSVNVGSEILGETIIFLVAALIIIAEYKRNSLKEAKKEFILNHKLE.TLKLQVLELQKENDEIMKI
DSQ  CCACTTTTTAAAATTGGGATTGTTTTAATAAGACAGGTAAGTAAACCTATATCAGGTTATATAAAAAAGAAAGCTATAGATAATAAAAATTTTAAGAGTATATGT---ATATATTGTGGTAAAAAATATTATTTCTTTGAACAATATATACAAAAAAAATTTTATAATTCTAATACGACCAATATTAATTATAGTTCTTATATTAGTGAGAACAAATCAGTAAATGTAGGTAGTGAAATTTTAGGTGAAACTATTATATTTTTAGTTGCAGCTTTAATAATTATAGCAGAATATAAAAGAAATAGTTTAAAAGAAGCAAAAAAAGAATTTATACTAAATCATAAATTAGAA...ACATTAAAATTACAAGTTTTGGAATTACAAAAAGAAAATGATGAAATTATGAAAATT
TRN  10010101110011000
//