EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07045 - DUF1330)
FAM  PF07045
PID  DUF1330
DES  Protein of unknown function (DUF1330)
IPR  IPR010753
ANO  16
ALN  96
AID  0.359124
APH  (((((((((Q8FXW8_BRUSU/3-94:0.06142,Q98DD6_RHILO/3-94:0.29330):0.13674,Q8UIJ7_AGRT5/3-94:0.08690):0.06099,Q92SN9_RHIME/3-94:0.15590):0.22883,(Q98CT4_RHILO/9-100:0.73906,Q9LCS9_BRAJA/3-94:0.34735):0.14708):0.17528,Q882F9_PSESM/2-94:0.30303):0.28354,(Q8Y0B6_RALSO/3-95:0.53539,Q87W43_PSESM/6-99:0.53867):0.14515):0.17757,((Q89JB1_BRAJA/14-106:0.38693,Q984S8_RHILO/2-94:0.31013):0.30180,Q98G06_RHILO/23-115:0.76689):0.10627):0.22108,(Q930M0_RHIME/2-93:0.61978,Q89X32_BRAJA/22-114:0.86007):0.17005):0.29720,Q89BY8_BRAJA/66-158:0.41793,O85836_SPHAR/2-93:0.91631);
ATP  (((((((((Q8FXW8_BRUSU/3-94,Q98DD6_RHILO/3-94),Q8UIJ7_AGRT5/3-94),Q92SN9_RHIME/3-94),(Q98CT4_RHILO/9-100,Q9LCS9_BRAJA/3-94)),Q882F9_PSESM/2-94),(Q8Y0B6_RALSO/3-95,Q87W43_PSESM/6-99)),((Q89JB1_BRAJA/14-106,Q984S8_RHILO/2-94),Q98G06_RHILO/23-115)),(Q930M0_RHIME/2-93,Q89X32_BRAJA/22-114)),Q89BY8_BRAJA/66-158,O85836_SPHAR/2-93);
ATL  9.92365
DNO  16
DLN  288
DID  0.4831
DPH  (((((Q87W43_PSESM/6-99:0.53116,Q8Y0B6_RALSO/3-95:0.38213):0.09421,((((Q98CT4_RHILO/9-100:0.45417,Q9LCS9_BRAJA/3-94:0.20463):0.14150,(Q92SN9_RHIME/3-94:0.18210,(Q8UIJ7_AGRT5/3-94:0.17112,(Q8FXW8_BRUSU/3-94:0.12458,Q98DD6_RHILO/3-94:0.19587):0.09308):0.06708):0.09688):0.07210,Q882F9_PSESM/2-94:0.33146):0.17181,((Q89JB1_BRAJA/14-106:0.28354,Q984S8_RHILO/2-94:0.26575):0.14851,Q98G06_RHILO/23-115:0.50044):0.06635):0.07428):0.08584,Q89X32_BRAJA/22-114:0.50708):0.13506,Q930M0_RHIME/2-93:0.40659):0.08714,Q89BY8_BRAJA/66-158:0.26080,O85836_SPHAR/2-93:0.53144);
DTP  (((((Q87W43_PSESM/6-99,Q8Y0B6_RALSO/3-95),((((Q98CT4_RHILO/9-100,Q9LCS9_BRAJA/3-94),(Q92SN9_RHIME/3-94,(Q8UIJ7_AGRT5/3-94,(Q8FXW8_BRUSU/3-94,Q98DD6_RHILO/3-94)))),Q882F9_PSESM/2-94),((Q89JB1_BRAJA/14-106,Q984S8_RHILO/2-94),Q98G06_RHILO/23-115))),Q89X32_BRAJA/22-114),Q930M0_RHIME/2-93),Q89BY8_BRAJA/66-158,O85836_SPHAR/2-93);
DTL  6.6667
RID  0.359124
RPH  (((((((((Q8FXW8_BRUSU/3-94:0.06142,Q98DD6_RHILO/3-94:0.29330):0.13674,Q8UIJ7_AGRT5/3-94:0.08690):0.06099,Q92SN9_RHIME/3-94:0.15590):0.22883,(Q98CT4_RHILO/9-100:0.73906,Q9LCS9_BRAJA/3-94:0.34735):0.14708):0.17528,Q882F9_PSESM/2-94:0.30303):0.28354,(Q8Y0B6_RALSO/3-95:0.53539,Q87W43_PSESM/6-99:0.53867):0.14515):0.17757,((Q89JB1_BRAJA/14-106:0.38693,Q984S8_RHILO/2-94:0.31013):0.30180,Q98G06_RHILO/23-115:0.76689):0.10627):0.22108,(Q930M0_RHIME/2-93:0.61978,Q89X32_BRAJA/22-114:0.86007):0.17005):0.29720,Q89BY8_BRAJA/66-158:0.41793,O85836_SPHAR/2-93:0.91631);
RTP  (((((((((Q8FXW8_BRUSU/3-94,Q98DD6_RHILO/3-94),Q8UIJ7_AGRT5/3-94),Q92SN9_RHIME/3-94),(Q98CT4_RHILO/9-100,Q9LCS9_BRAJA/3-94)),Q882F9_PSESM/2-94),(Q8Y0B6_RALSO/3-95,Q87W43_PSESM/6-99)),((Q89JB1_BRAJA/14-106,Q984S8_RHILO/2-94),Q98G06_RHILO/23-115)),(Q930M0_RHIME/2-93,Q89X32_BRAJA/22-114)),Q89BY8_BRAJA/66-158,O85836_SPHAR/2-93);
RTL  9.92365
LNK  O85836_SPHAR/2-93:O85836:AF079317
LNK  Q87W43_PSESM/6-99:Q87W43:AE016873
LNK  Q882F9_PSESM/2-94:Q882F9:AE016865
LNK  Q89BY8_BRAJA/66-158:Q89BY8:BA000040
LNK  Q89JB1_BRAJA/14-106:Q89JB1:BA000040
LNK  Q89X32_BRAJA/22-114:Q89X32:BA000040
LNK  Q8FXW8_BRUSU/3-94:Q8FXW8:AE014291
LNK  Q8UIJ7_AGRT5/3-94:Q8UIJ7:AE009001
LNK  Q8Y0B6_RALSO/3-95:Q8Y0B6:AL646062
LNK  Q92SN9_RHIME/3-94:Q92SN9:AL591783
LNK  Q930M0_RHIME/2-93:Q930M0:AE007211
LNK  Q984S8_RHILO/2-94:Q984S8:BA000012
LNK  Q98CT4_RHILO/9-100:Q98CT4:BA000012
LNK  Q98DD6_RHILO/3-94:Q98DD6:BA000012
LNK  Q98G06_RHILO/23-115:Q98G06:BA000012
LNK  Q9LCS9_BRAJA/3-94:Q9LCS9:Y09633
AMK  xxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q98G06_RHILO/23-115
ASQ  TAYAIAHMrQVTMGPQIVEYLHKIDATLEPFGGRFLVHGGDVEVIEND.WPG-NLIVIEFPDRRHVREWYDSPAYQAILSLRTDNS.DSDVIIVDG
DSQ  ACCGCTTACGCAATCGCCCATATGcgcCAAGTCACGATGGGTCCGCAGATCGTCGAGTACCTGCACAAGATCGATGCCACGCTGGAGCCTTTCGGCGGCCGTTTCCTGGTCCATGGCGGCGATGTTGAGGTGATCGAGAACGAC...TGGCCGGGC---AACCTCATCGTCATCGAATTTCCCGACCGGCGGCATGTGCGCGAGTGGTATGATTCGCCCGCCTATCAGGCGATCCTTTCACTGCGCACCGATAATTCG...GACTCTGACGTAATCATCGTTGACGGC
TRN  11011111101111101
NAM  Q984S8_RHILO/2-94
ASQ  PAYIISDV.TICDQEAFQTYRSRAAASIAHYGGRYLVRGGQVDTLEGE.WHPTPLIVVEFPDIEQARRWYASAEYAAALDVRDAAL.SRHLILVDG
DSQ  CCTGCCTATATCATTTCCGATGTC...ACCATCTGCGACCAAGAGGCATTCCAGACATACCGCTCGCGTGCCGCGGCTTCCATTGCCCATTATGGCGGGCGCTATCTCGTACGCGGCGGCCAGGTGGATACGCTGGAGGGCGAA...TGGCATCCCACGCCGCTGATCGTTGTCGAATTTCCTGACATTGAGCAGGCACGGCGCTGGTACGCATCCGCCGAGTATGCTGCAGCGCTAGATGTGCGCGACGCCGCGCTC...AGCCGCCATCTGATCCTTGTCGACGGC
TRN  11011111101111111
NAM  Q89JB1_BRAJA/14-106
ASQ  PAYVISEV.EVRDQAMMEAYRALAAQTIAQYGGRYLARGGAADVVEGG.PPPKTIIIVEFPTMARAREWYASVEYAEALKLRQTAL.ERRLMFVEG
DSQ  CCGGCTTATGTGATCTCCGAGGTC...GAGGTGCGCGATCAGGCGATGATGGAAGCCTATCGCGCGCTTGCGGCGCAGACTATCGCGCAATATGGCGGCCGCTACCTCGCGCGCGGCGGTGCCGCCGATGTGGTGGAGGGCGGC...CCGCCGCCCAAGACCATCATCATCGTGGAGTTTCCCACGATGGCCCGCGCGCGCGAATGGTACGCCTCAGTGGAATATGCCGAGGCGTTGAAGCTGCGACAGACGGCGCTG...GAGCGGCGGTTGATGTTCGTCGAGGGC
TRN  11011111101111101
NAM  Q98DD6_RHILO/3-94
ASQ  KGYWIARV.DVRDAEGYKEYIAASKLAFERFGAKFLARGGAHELAEGP.GRA-RNVIIEFESLAVAHDCYHSPEYQRAVAIRQKVA.DGEIVLVEG
DSQ  AAGGGATACTGGATCGCCCGCGTC...GATGTGCGCGATGCCGAAGGCTACAAGGAGTATATCGCCGCTTCGAAGCTCGCCTTCGAGCGTTTTGGCGCGAAATTCCTGGCGCGCGGCGGAGCCCATGAACTGGCCGAGGGGCCT...GGCCGCGCC---CGCAACGTGATCATCGAATTCGAATCGCTTGCGGTCGCGCATGACTGCTACCATTCGCCGGAATATCAGCGCGCGGTCGCCATCCGCCAGAAGGTCGCC...GACGGCGAGATCGTGCTGGTCGAAGGG
TRN  11011101101011011
NAM  Q8FXW8_BRUSU/3-94
ASQ  KAYWIARV.DVRDPERYKDYVSTAKPAFERFGANFIARGGKADAVEGP.GRA-RNVIIEFETMQHALDCYNSPEYQAAAAIRQTVA.DGEIVIVEG
DSQ  AAAGCCTATTGGATTGCCCGCGTG...GATGTTCGCGATCCCGAACGCTACAAGGATTATGTTTCGACGGCCAAGCCCGCTTTTGAGCGGTTCGGCGCGAATTTCATCGCTCGTGGCGGCAAGGCGGACGCGGTGGAGGGGCCG...GGCCGGGCC---CGCAATGTCATCATCGAATTTGAAACGATGCAACACGCGCTTGATTGCTATAATTCACCTGAATATCAGGCCGCAGCCGCCATCCGCCAGACAGTGGCG...GACGGTGAGATCGTGATCGTCGAAGGC
TRN  11011101111011001
NAM  Q8UIJ7_AGRT5/3-94
ASQ  KGYWIAQV.DVRDSERYKDYVSTAKPAFERFGANFLARGGSVTELEGT.ARA-RNVVIEFPSVQHAIDCYNSPEYQAAAKIRQEVA.DAEMMIVEG
DSQ  AAGGGATATTGGATCGCCCAAGTC...GATGTACGCGACAGCGAGCGTTACAAGGACTATGTCTCCACAGCCAAGCCCGCCTTCGAGCGGTTCGGCGCCAATTTTCTGGCTCGCGGCGGTTCGGTGACGGAACTGGAAGGCACG...GCGCGTGCG---CGCAACGTTGTCATCGAGTTCCCGTCCGTCCAGCATGCGATTGACTGCTACAACTCTCCCGAATACCAGGCGGCGGCGAAAATCCGCCAGGAAGTAGCA...GATGCGGAGATGATGATCGTCGAAGGA
TRN  11011101101011011
NAM  Q92SN9_RHIME/3-94
ASQ  KGYWIARV.DIRDPERYKDYVTAATPAFEKYGATFLARGGQFHRLEGA.ART-RNVVIEFPSLQAAVDCYNSPEYQIAAAIRQEVA.DAEMVVVEG
DSQ  AAAGGATACTGGATCGCTCGGGTC...GATATAAGGGACCCCGAACGCTATAAGGATTACGTGACAGCGGCGACGCCCGCCTTCGAAAAATACGGCGCGACCTTCCTCGCGCGCGGCGGGCAGTTCCATCGGCTCGAAGGTGCC...GCTCGTACC---CGCAACGTCGTCATCGAATTCCCCTCGCTGCAGGCGGCCGTCGACTGTTACAATTCGCCCGAATACCAGATTGCCGCGGCCATCCGCCAGGAAGTCGCC...GATGCCGAAATGGTCGTCGTAGAGGGT
TRN  10010101100011011
NAM  Q882F9_PSESM/2-94
ASQ  KAYWIAHV.DVTDPQQYSEYTQRAPAAFQLFGGKFLARGGRSEAIEGR.ATPQRTVIIEFESYEQAVACYHSPQYQNAMSHRQGAA.KAEIVIVEG
DSQ  AAGGCTTATTGGATTGCCCACGTG...GATGTGACCGACCCTCAGCAGTACAGCGAATATACCCAGCGCGCGCCAGCCGCTTTCCAGCTGTTTGGCGGCAAATTTCTCGCCCGGGGCGGCCGCTCGGAAGCGATTGAAGGGCGA...GCAACGCCGCAACGCACGGTGATTATCGAATTTGAATCCTACGAACAGGCAGTTGCCTGTTACCACTCGCCCCAATACCAGAATGCCATGAGCCATCGGCAGGGCGCGGCA...AAGGCCGAAATCGTGATAGTTGAGGGG
TRN  10010101100011011
NAM  Q9LCS9_BRAJA/3-94
ASQ  KGYWIGRV.DVNSDEGYKPYAVANGAIFKKWGGRFVVRGGKFTTVEGA.SRT-RNVVIEFPDYETAIACYNSPEYQANIKVRQPHS.VADLIIIEG
DSQ  AAAGGCTACTGGATCGGGCGCGTC...GATGTGAACAGTGACGAGGGCTACAAGCCTTATGCCGTCGCCAACGGCGCGATCTTCAAGAAATGGGGCGGCCGCTTCGTCGTCCGCGGCGGCAAGTTCACCACCGTCGAAGGTGCC...AGCCGCACC---CGCAACGTCGTGATCGAATTCCCGGACTACGAGACCGCGATCGCCTGCTACAACTCACCGGAATACCAGGCCAACATCAAGGTGCGCCAGCCGCACTCG...GTCGCCGACCTCATCATCATCGAGGGC
TRN  11011101111011001
NAM  Q98CT4_RHILO/9-100
ASQ  KGYWMVML.TVTDAEGYQRYREAIGDAISHFGGRYLVRGGEVTNPEGS.DFG-RHVVVEFDSYETALSCYRSQGYQTALQHRVAAS.TGHFAIVEG
DSQ  AAAGGGTATTGGATGGTGATGCTC...ACGGTGACCGATGCCGAGGGTTACCAGCGCTATCGTGAAGCCATTGGCGATGCCATTTCGCACTTTGGCGGCCGCTACCTTGTGCGCGGCGGAGAGGTCACAAACCCCGAAGGATCC...GATTTTGGC---AGGCATGTGGTGGTCGAATTCGACTCCTATGAAACGGCCCTGAGTTGCTATCGGTCGCAGGGCTACCAGACGGCGTTGCAGCATCGAGTGGCAGCTTCA...ACCGGTCATTTCGCGATCGTAGAGGGT
TRN  10010101100011001
NAM  Q8Y0B6_RALSO/3-95
ASQ  AGYILASV.DVTDPVQYEQYKVLSTRAMQAHGAEPLVRGGKTEPLEGE.WNPTRVVVLKFKSYDAAKSFYDSEEYHAARDARAKAA.HVNMIVVEG
DSQ  GCTGGCTACATCCTCGCGTCCGTG...GACGTGACCGATCCTGTGCAGTACGAGCAATACAAGGTGCTGTCGACCCGGGCCATGCAGGCCCATGGCGCGGAACCGCTGGTGCGCGGCGGCAAAACCGAACCGCTGGAAGGCGAA...TGGAACCCGACGCGCGTGGTCGTGCTCAAGTTCAAGAGCTACGATGCCGCCAAGTCGTTCTACGACAGCGAGGAATACCATGCGGCCCGCGACGCGCGCGCTAAGGCCGCC...CACGTGAACATGATTGTGGTCGAGGGC
TRN  11011101101011011
NAM  Q87W43_PSESM/6-99
ASQ  SAYLIGKM.SITDQARYDNYKRLTPDIVKAHGGRFISRGGQKFLLEGE.AESRRVVIVEFPSVEAAQKFYNSEEYTKARHLREGAAdEMQLFIVEG
DSQ  AGCGCCTATCTTATTGGTAAAATG...AGTATCACCGACCAAGCTCGGTATGATAATTACAAGCGGCTAACGCCTGACATTGTGAAAGCTCATGGAGGCCGCTTCATCTCGAGAGGAGGCCAGAAGTTTCTTTTGGAAGGAGAG...GCTGAAAGCCGTCGTGTGGTGATTGTAGAGTTCCCTTCAGTTGAGGCAGCACAGAAGTTCTACAATTCTGAAGAGTATACAAAGGCTAGACACCTCCGCGAAGGTGCAGCCgacGAGATGCAATTGTTCATTGTGGAGGGA
TRN  10010101110011001
NAM  Q89X32_BRAJA/22-114
ASQ  TVYAIAQL.KMTDRAAYDRYQARFFDVFRKYSGRLLAADEQPRVLEGT.WPYDKLVMMSFPDEAAFVAFSNSADYEDISRDRKAGA.QATVLLVKG
DSQ  ACTGTCTACGCGATCGCGCAATTG...AAGATGACGGACCGCGCGGCCTATGACCGCTACCAGGCGCGGTTCTTCGATGTGTTCAGGAAGTACAGCGGGCGGCTTCTCGCGGCCGACGAACAGCCCCGCGTGCTCGAAGGCACC...TGGCCCTATGACAAACTTGTCATGATGTCGTTTCCCGACGAAGCCGCGTTTGTTGCCTTCTCCAACTCAGCCGACTACGAGGACATCTCGCGCGATCGCAAGGCGGGCGCG...CAGGCGACCGTGCTGCTGGTGAAGGGA
TRN  10010101100011001
NAM  Q930M0_RHIME/2-93
ASQ  SAYLIVDL.DIHDMKSIEDYRSKALPLVAKAGGKLIAIDESPLELEG-.WIATNMLIIEFPDKDAIRQLFASPEYAPLAAQRQAAA.ASRIIAING
DSQ  TCTGCCTATCTCATTGTCGATCTA...GACATACACGACATGAAGTCCATCGAAGACTACCGGTCGAAGGCACTGCCGCTCGTCGCCAAAGCTGGCGGCAAGCTCATCGCCATCGATGAAAGCCCTCTGGAGTTGGAAGGC---...TGGATCGCCACCAACATGCTCATCATCGAGTTTCCGGACAAGGATGCGATCCGTCAGCTCTTCGCATCCCCCGAATACGCGCCCTTGGCCGCACAGCGGCAGGCTGCGGCC...GCATCGCGCATCATAGCGATCAACGGC
TRN  10010101100011011
NAM  O85836_SPHAR/2-93
ASQ  AAYFIGSI.KSHDETWVAGYMAAVPALVGRHGGEMVCRSHEFVRYEGEgAAPDYVVVIRFPSMEAIDAFMNDPDYAPHKDARIACA.TSDIFAI--
DSQ  GCTGCCTATTTCATCGGATCGATC...AAATCGCACGACGAAACCTGGGTGGCAGGCTATATGGCCGCAGTTCCGGCGCTGGTCGGACGCCACGGCGGGGAAATGGTCTGCCGTTCGCACGAGTTCGTCCGTTATGAGGGCGAGggaGCCGCACCTGACTATGTCGTGGTGATCCGGTTTCCTTCGATGGAGGCGATCGACGCCTTCATGAACGATCCGGACTATGCGCCGCACAAGGATGCGCGCATCGCCTGCGCC...ACATCGGATATCTTCGCGATC------
TRN  11011101101011011
NAM  Q89BY8_BRAJA/66-158
ASQ  PAYFIVQN.TIKDEAQYQKYVQAVVPFIASFGGKLVARRAKVEVLEGE.HDQRPVVMFEFPDMEAIHAFWNSPDYVPIKKLREGIA.TMNIWAFPG
DSQ  CCCGCCTATTTTATTGTCCAAAAC...ACCATCAAGGACGAAGCGCAGTACCAGAAATACGTGCAGGCCGTCGTGCCGTTCATAGCCAGCTTTGGCGGAAAACTTGTAGCCAGACGAGCGAAGGTGGAGGTGCTGGAAGGCGAA...CACGATCAGCGCCCGGTCGTCATGTTCGAGTTTCCCGACATGGAGGCGATCCACGCGTTCTGGAACTCGCCGGACTACGTTCCGATCAAGAAACTGCGCGAGGGTATAGCC...ACCATGAACATCTGGGCTTTTCCCGGC
TRN  10010101100011011
//