EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07021 - MetW)
FAM  PF07021
PID  MetW
DES  Methionine biosynthesis protein MetW
IPR  IPR010743
ANO  7
ALN  195
AID  0.459506
APH  (((((Q9JUU0_NEIMA/4-192:0.41727,Q8Y3F4_RALSO/25-212:0.43861):0.13925,Q87V89_PSESM/2-194:0.33904):0.23493,Q8F4I1_LEPIN/17-204:0.56389):0.14506,Q9AAS2_CAUCR/6-200:0.42709):0.12519,Q89UL6_BRAJA/24-217:0.36339,Q98G08_RHILO/8-202:0.16436);
ATP  (((((Q9JUU0_NEIMA/4-192,Q8Y3F4_RALSO/25-212),Q87V89_PSESM/2-194),Q8F4I1_LEPIN/17-204),Q9AAS2_CAUCR/6-200),Q89UL6_BRAJA/24-217,Q98G08_RHILO/8-202);
ATL  3.35808
DNO  7
DLN  585
DID  0.538124
DPH  (Q9JUU0_NEIMA/4-192:0.33497,Q8Y3F4_RALSO/25-212:0.32751,((Q8F4I1_LEPIN/17-204:0.58997,((Q89UL6_BRAJA/24-217:0.24938,Q98G08_RHILO/8-202:0.18654):0.08531,Q9AAS2_CAUCR/6-200:0.28468):0.07908):0.12430,Q87V89_PSESM/2-194:0.23553):0.09459);
DTP  (Q9JUU0_NEIMA/4-192,Q8Y3F4_RALSO/25-212,((Q8F4I1_LEPIN/17-204,((Q89UL6_BRAJA/24-217,Q98G08_RHILO/8-202),Q9AAS2_CAUCR/6-200)),Q87V89_PSESM/2-194));
DTL  2.59186
RID  0.459506
RPH  (((((Q9JUU0_NEIMA/4-192:0.41727,Q8Y3F4_RALSO/25-212:0.43861):0.13925,Q87V89_PSESM/2-194:0.33904):0.23493,Q8F4I1_LEPIN/17-204:0.56389):0.14506,Q9AAS2_CAUCR/6-200:0.42709):0.12519,Q89UL6_BRAJA/24-217:0.36339,Q98G08_RHILO/8-202:0.16436);
RTP  (((((Q9JUU0_NEIMA/4-192,Q8Y3F4_RALSO/25-212),Q87V89_PSESM/2-194),Q8F4I1_LEPIN/17-204),Q9AAS2_CAUCR/6-200),Q89UL6_BRAJA/24-217,Q98G08_RHILO/8-202);
RTL  3.35808
LNK  Q87V89_PSESM/2-194:Q87V89:AE016874
LNK  Q89UL6_BRAJA/24-217:Q89UL6:BA000040
LNK  Q8F4I1_LEPIN/17-204:Q8F4I1:AE011378
LNK  Q8Y3F4_RALSO/25-212:Q8Y3F4:AL646057
LNK  Q98G08_RHILO/8-202:Q98G08:BA000012
LNK  Q9AAS2_CAUCR/6-200:Q9AAS2:AE005724
LNK  Q9JUU0_NEIMA/4-192:Q9JUU0:AL162755
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9JUU0_NEIMA/4-192
ASQ  RDDLQLIYDRIPEGSRVLDLGCGDGELLAASVEHKKCSGYGIEIDTDSVIAAMSRGVNVIQADLEEGLTAFNDQSFDVIVLSQTIQAMQNTEKILRCLMRVAKQAIVSFPNFGYWRNRVQIALGGHMPVSERMPYHWYDTPNIHWCTLKDFDLLCAKNNIRVLERAVMTGNR------QVKHFPNLLGSLAFYRV
DSQ  CGCGATGATTTGCAACTGATTTACGACCGGATACCCGAAGGCAGCCGCGTCTTGGACTTGGGCTGCGGCGACGGCGAACTGCTTGCCGCCTCGGTCGAACACAAAAAATGCAGCGGCTACGGCATCGAAATCGACACCGACAGCGTGATTGCCGCGATGTCGCGCGGCGTGAATGTTATCCAAGCCGATTTGGAAGAAGGTTTAACCGCATTCAACGATCAAAGTTTTGATGTGATTGTGTTGAGCCAGACCATCCAAGCGATGCAGAATACCGAAAAAATCCTGCGCTGCCTGATGCGCGTGGCAAAACAGGCAATCGTCAGCTTCCCGAATTTCGGCTACTGGCGCAACCGCGTCCAAATCGCACTCGGCGGACATATGCCGGTTTCCGAACGTATGCCCTACCATTGGTACGACACGCCCAATATCCATTGGTGCACGCTCAAAGACTTTGATTTGTTGTGCGCCAAAAACAACATCCGCGTGCTTGAGCGCGCCGTGATGACGGGCAACAGA------------------CAGGTCAAACATTTCCCCAACCTTTTGGGCAGCCTTGCATTTTACCGCGTC
TRN  10010101100011010
NAM  Q87V89_PSESM/2-194
ASQ  RADLEIIQEWIPAGSRVLDLGCGDGELLTWLRDHKQVTGYGLENDAANIAECVAKGINVIEQDLDKGLGNFASNSFDVVVMTQALQAVHYPDRILDEMLRVGRQCIITFPNFGHWRCRWYLASKGRMPVSDFLPYTWYNTPNIHFCTFGDFEELCRERDAQVLDRLAVDQQHRHGW--ASKLWPNLLGEIGIYRV
DSQ  AGAGCCGATCTGGAAATCATCCAGGAATGGATCCCCGCAGGCAGCCGTGTGCTCGACCTCGGTTGCGGCGACGGCGAATTGCTGACCTGGCTGCGTGATCACAAGCAGGTCACCGGTTACGGGCTGGAAAACGACGCAGCCAACATCGCCGAATGCGTGGCCAAGGGCATTAACGTCATCGAGCAGGACCTCGACAAGGGGCTGGGCAACTTTGCCAGCAACAGCTTTGACGTGGTGGTCATGACCCAGGCCCTGCAAGCGGTGCATTACCCGGACAGAATCCTCGACGAGATGCTGCGCGTCGGACGTCAGTGCATCATCACCTTCCCGAACTTCGGCCATTGGCGCTGCCGCTGGTATCTGGCGAGCAAAGGCCGCATGCCGGTGTCGGATTTTCTGCCGTACACCTGGTACAACACACCGAACATCCACTTCTGCACCTTCGGCGACTTCGAAGAACTGTGCCGCGAGCGCGACGCACAGGTGCTCGACAGGCTAGCCGTCGATCAGCAGCACCGTCACGGCTGG------GCCAGCAAACTGTGGCCCAATCTGCTCGGCGAAATCGGTATCTACCGGGTC
TRN  10010101100011011
NAM  Q8Y3F4_RALSO/25-212
ASQ  RADFRAIARWIEPRSTVLDLGCGDGSLLRVLQNELDVLAYGIEIDDAGVLAATQKGLHVIQQNLEGGLALFEDKSFDMVILSQTLQTIHNTAQVLREMLRVGRECIVSFPNFGYWPHRLSIF-RGRMPVSKSLPYEWYDTPNVRVLTIRDFEALAPKVGLVILDRVVLHEGR------AVHWGANWRGNVAVYRV
DSQ  CGCGCCGACTTCCGCGCCATCGCCCGCTGGATCGAACCGCGCTCCACCGTGCTCGACCTGGGCTGCGGCGACGGCAGCCTGCTGCGCGTACTGCAAAACGAGCTGGACGTGCTGGCCTACGGCATCGAGATCGACGACGCCGGCGTGCTGGCCGCCACGCAGAAAGGCTTGCACGTGATCCAGCAGAACCTGGAAGGCGGCCTGGCGCTGTTCGAAGACAAGAGCTTCGATATGGTGATCCTCTCGCAGACCCTGCAGACCATCCACAACACCGCGCAGGTGCTGCGCGAGATGCTGCGGGTGGGGCGCGAGTGCATCGTGTCGTTCCCGAACTTCGGCTACTGGCCGCACCGGCTGTCGATCTTC---CGCGGGCGCATGCCGGTATCGAAATCGCTGCCGTACGAGTGGTACGACACGCCCAACGTGCGCGTGCTGACCATCCGCGACTTCGAGGCGCTGGCGCCCAAGGTCGGGCTGGTGATCCTCGACCGCGTCGTGCTGCACGAGGGCAGG------------------GCGGTGCACTGGGGGGCCAACTGGCGCGGCAACGTGGCGGTCTATCGCGTG
TRN  10010101100011011
NAM  Q9AAS2_CAUCR/6-200
ASQ  REDFREILRLVRPGSRVLDVGCGEGVLLDLLAHEKQVDARGLELSASGVAACMARGLSVVQGDADLDLDHFPDRSFDYAVLSQTLQATRNPRHVLDELLRIADRAIVSFPNFGHWRVRWSLLSRGRMPETKALPLPWWSTPNIHLCTLADFMALTQDLNLRVDASAAFAGKGAARPMNPTSAWENWRSETCLFML
DSQ  CGCGAGGACTTCCGCGAAATCCTGCGCCTGGTGCGCCCCGGCTCGCGCGTGCTGGATGTCGGCTGCGGCGAAGGTGTGCTGCTGGACCTTCTGGCCCATGAAAAGCAGGTGGACGCTCGGGGCCTGGAGCTCAGCGCCTCGGGCGTGGCCGCCTGCATGGCGCGTGGCCTGTCGGTCGTGCAGGGCGACGCTGACCTGGATCTCGACCACTTCCCCGATCGCTCGTTCGACTATGCGGTGCTGTCTCAGACCCTGCAGGCGACGCGCAATCCGCGTCACGTGCTGGACGAGCTGCTGCGCATCGCTGATCGGGCCATCGTCTCGTTCCCGAACTTCGGCCACTGGCGCGTGCGCTGGTCGCTCTTGAGCCGTGGCCGGATGCCCGAGACCAAGGCCCTGCCCCTGCCCTGGTGGTCGACCCCGAACATCCACCTCTGCACCCTGGCCGACTTCATGGCCCTGACCCAGGATCTCAACCTGCGGGTCGACGCCAGCGCCGCCTTCGCCGGCAAGGGCGCGGCGCGGCCGATGAACCCGACCAGCGCCTGGGAGAACTGGCGCAGCGAAACCTGCCTGTTCATGCTC
TRN  11011111101111111
NAM  Q98G08_RHILO/8-202
ASQ  RVDLEVVANLIPPQSRVLDVGSGDGSLLELLQDTKQVDGRGLELSQRGVNECVARGLSVIQGDADKDLEFYPDKGFDFVVLSQTLQATRNPKLVLDELLRIGNRAIVSFPNFGHWRVRLSLFVKGRMPVTQDLPYSWYDTPNIHFCTIRDFVNLCEELGATVEKATALDAAGQKIGLSMPWWFWNFFGQQAVFLL
DSQ  CGCGTCGACCTCGAGGTCGTCGCCAACCTCATCCCACCGCAGTCCCGCGTGCTCGACGTCGGTTCGGGCGACGGATCGCTGCTTGAATTGCTGCAGGACACCAAGCAGGTCGACGGCCGCGGGCTTGAGCTGTCGCAGCGCGGCGTCAACGAATGCGTGGCACGCGGCCTCTCCGTCATCCAGGGCGATGCCGACAAGGATCTCGAATTCTATCCCGACAAGGGCTTTGACTTCGTCGTCCTGTCGCAGACCTTGCAGGCCACCCGCAACCCGAAGCTGGTGCTCGACGAACTGCTCCGCATCGGCAACCGGGCGATCGTCTCCTTCCCCAATTTCGGCCATTGGCGGGTGCGTCTGTCGCTGTTCGTCAAGGGCCGCATGCCGGTGACCCAGGACCTGCCCTATTCCTGGTACGACACCCCCAACATCCACTTCTGCACCATCCGCGATTTCGTCAATTTGTGCGAAGAACTCGGCGCGACGGTGGAAAAGGCGACCGCGCTCGACGCCGCCGGCCAGAAGATCGGCCTGTCCATGCCCTGGTGGTTCTGGAACTTCTTTGGCCAGCAGGCGGTGTTCCTGCTG
TRN  11011111101111111
NAM  Q89UL6_BRAJA/24-217
ASQ  RADHLLVAEMVKPGSKVLDVGCGDGDLLQLL-ETRGIDGRGIELSREGVNRCVAKGLAVVQGDADTDLVNYPDDAFDYVILSQTLQATRQPRVVLENLLRIGRRAIVSFPNFGFWKMRLQLLIGGHMPRTENLPATWYDTANIHFCTIKDFVELCDEINVKMERSVALDLYGRPVPLNLPWWVWNMFGEQGVFLL
DSQ  CGCGCCGACCATCTGCTCGTCGCCGAGATGGTCAAGCCGGGCTCCAAGGTGCTCGATGTCGGCTGCGGTGACGGTGATCTGCTCCAGCTTCTG---GAGACCCGCGGCATCGACGGTCGCGGCATCGAATTGTCGCGCGAGGGCGTCAACCGCTGCGTCGCCAAGGGCCTCGCGGTGGTGCAGGGCGACGCCGATACCGACCTCGTGAACTATCCCGATGATGCCTTCGACTACGTGATCCTGTCGCAGACGCTCCAGGCGACGCGGCAGCCGCGTGTGGTGTTGGAAAATCTCCTGCGCATCGGCCGCCGCGCCATCGTCTCGTTCCCGAACTTCGGCTTCTGGAAGATGCGGCTCCAACTCCTGATCGGCGGCCACATGCCGCGCACCGAGAACCTGCCGGCGACCTGGTACGACACCGCCAACATCCACTTCTGCACCATCAAGGATTTCGTCGAGCTCTGCGACGAGATCAACGTCAAGATGGAACGCTCGGTGGCGCTCGATCTCTATGGCCGCCCGGTGCCGCTGAACCTGCCCTGGTGGGTGTGGAATATGTTCGGCGAGCAGGGCGTGTTTCTGCTC
TRN  11011111101111111
NAM  Q8F4I1_LEPIN/17-204
ASQ  RPDFAYILNLIPDGSRVLDLGCGNGTLLYLLKE-KGIRGQGIEKDEDCIVECIQRGVYVHHGDIDEGLEHHQDKRFDYVILNQTIQETRNPGEILKESLRIGKKVIVAFPNFGHWNVRWKILTTGKTPVTDLLPYRWFNTPNLHFLSVLDFIEFCEIQKFKIEDRAYFRDLS------QVRFRPNFFSKLALFVI
DSQ  AGACCGGACTTCGCCTACATTCTCAACTTGATTCCTGACGGCTCTAGAGTTTTGGATTTAGGATGTGGAAACGGAACGTTACTCTATCTTTTAAAAGAA---AAAGGAATCCGAGGACAGGGAATCGAAAAAGATGAAGATTGTATCGTAGAATGTATCCAACGAGGAGTCTATGTTCATCACGGAGATATCGACGAAGGTTTGGAACATCATCAAGACAAACGTTTTGATTACGTAATTCTCAACCAAACGATTCAAGAAACTAGAAATCCAGGAGAAATTTTAAAAGAATCGTTGCGGATCGGTAAAAAAGTAATCGTAGCATTTCCAAACTTCGGACACTGGAACGTTCGTTGGAAAATTTTGACCACGGGTAAAACACCTGTAACAGATTTGCTTCCCTATCGCTGGTTCAATACTCCTAACCTTCATTTTCTTTCAGTTTTGGATTTTATAGAATTTTGCGAAATCCAAAAATTTAAGATCGAAGACAGGGCTTACTTCAGAGATTTATCC------------------CAGGTTCGCTTTCGCCCCAACTTCTTTTCTAAGCTTGCGCTTTTCGTAATA
TRN  10010101110011000
//