EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07020 - Orthopox_C10L)
FAM  PF07020
PID  Orthopox_C10L
DES  Orthopoxvirus C10L protein
IPR  IPR009748
ANO  2
ALN  63
AID  0.965517
APH  (Q66298_COWPX/1-63:0.02029,P87610_COWPX/1-62:0.04787);
ATP  (Q66298_COWPX/1-63,P87610_COWPX/1-62);
ATL  0.06817
DNO  2
DLN  189
DID  0.924731
DPH  (Q66298_COWPX/1-63:0.00555,P87610_COWPX/1-62:0.07546);
DTP  (Q66298_COWPX/1-63,P87610_COWPX/1-62);
DTL  0.081
RID  0.965517
RPH  (Q66298_COWPX/1-63:0.02029,P87610_COWPX/1-62:0.04787);
RTP  (Q66298_COWPX/1-63,P87610_COWPX/1-62);
RTL  0.06817
LNK  P87610_COWPX/1-62:P87610:X94355
LNK  Q66298_COWPX/1-63:Q66298:U59898
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q66298_COWPX/1-63
ASQ  MSSKGGSSGGMWSVFIHGHDGCSKGSKTYTSGGGGMWGGSSSGVKSGVNGGVNGGVNSGVNKI
DSQ  ATGTCTTCTAAAGGAGGTAGTAGCGGTGGTATGTGGAGTGTCTTCATTCACGGACATGATGGCTGTAGTAAAGGATCTAAAACTTATACATCTGGTGGAGGTGGAATGTGGGGAGGATCGTCTAGTGGTGTAAAAAGTGGAGTTAATGGAGGTGTTAACGGAGGTGTAAACTCTGGAGTTAATAAAATT
TRN  11111101111011011
NAM  P87610_COWPX/1-62
ASQ  MSSKGGS-GGMWSVFIHGHDGSSKGSKTYTSGGGGMWGGSSSGVKSGVNGGVNGGVKSGTGKI
DSQ  ATGTCTTCTAAAGGAGGTAGT---GGTGGCATGTGGAGTGTCTTTATCCATGGACATGATGGTAGTAGTAAAGGATCTAAAACTTATACATCTGGTGGCGGTGGAATGTGGGGAGGATCGTCAAGTGGTGTAAAAAGTGGGGTTAATGGAGGTGTTAACGGAGGTGTAAAATCTGGAACTGGTAAAATT
TRN  11111101111011001
//