EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06993 - DUF1304)
FAM  PF06993
PID  DUF1304
DES  Protein of unknown function (DUF1304)
IPR  IPR009732
ANO  13
ALN  124
AID  0.37195
APH  ((((((((Q8DUJ8_STRMU/3-116:0.35684,Q8NY56_STAAW/3-119:0.40974):0.12804,YPAA_LACLA/3-119:0.16867):0.02481,(Q8DWT0_STRA5/3-118:0.26985,Q97NG8_STRPN/3-115:0.29323):0.12536):0.41699,Q8NL72_CORGL/3-124:1.41989):0.15741,(Q88ZG4_LACPL/3-121:0.48239,Q9JVT5_NEIMA/3-122:0.56967):0.11629):0.14280,Q8Y9K9_LISMO/3-121:0.24141):0.53477,(Q8XFH2_RALSO/4-119:0.49109,Q8P6U4_XANCP/3-115:0.37369):0.04911):0.13525,Q8U4U8_AGRT5/21-135:0.39597,Q98F54_RHILO/3-115:0.18758);
ATP  ((((((((Q8DUJ8_STRMU/3-116,Q8NY56_STAAW/3-119),YPAA_LACLA/3-119),(Q8DWT0_STRA5/3-118,Q97NG8_STRPN/3-115)),Q8NL72_CORGL/3-124),(Q88ZG4_LACPL/3-121,Q9JVT5_NEIMA/3-122)),Q8Y9K9_LISMO/3-121),(Q8XFH2_RALSO/4-119,Q8P6U4_XANCP/3-115)),Q8U4U8_AGRT5/21-135,Q98F54_RHILO/3-115);
ATL  7.49082
DNO  13
DLN  372
DID  0.471164
DPH  (((((((((YPAA_LACLA/3-119:0.23603,(Q8DWT0_STRA5/3-118:0.19835,Q97NG8_STRPN/3-115:0.29368):0.09212):0.07008,Q8DUJ8_STRMU/3-116:0.30695):0.12950,Q8NY56_STAAW/3-119:0.36952):0.27819,Q88ZG4_LACPL/3-121:0.35064):0.09508,Q8Y9K9_LISMO/3-121:0.33442):0.13134,Q9JVT5_NEIMA/3-122:0.36503):0.15234,Q8NL72_CORGL/3-124:0.66406):0.14623,Q8P6U4_XANCP/3-115:0.20511):0.07984,Q8XFH2_RALSO/4-119:0.24878,(Q8U4U8_AGRT5/21-135:0.29649,Q98F54_RHILO/3-115:0.14753):0.12386);
DTP  (((((((((YPAA_LACLA/3-119,(Q8DWT0_STRA5/3-118,Q97NG8_STRPN/3-115)),Q8DUJ8_STRMU/3-116),Q8NY56_STAAW/3-119),Q88ZG4_LACPL/3-121),Q8Y9K9_LISMO/3-121),Q9JVT5_NEIMA/3-122),Q8NL72_CORGL/3-124),Q8P6U4_XANCP/3-115),Q8XFH2_RALSO/4-119,(Q8U4U8_AGRT5/21-135,Q98F54_RHILO/3-115));
DTL  5.31517
RID  0.37195
RPH  ((((((((Q8DUJ8_STRMU/3-116:0.35684,Q8NY56_STAAW/3-119:0.40974):0.12804,YPAA_LACLA/3-119:0.16867):0.02481,(Q8DWT0_STRA5/3-118:0.26985,Q97NG8_STRPN/3-115:0.29323):0.12536):0.41699,Q8NL72_CORGL/3-124:1.41989):0.15741,(Q88ZG4_LACPL/3-121:0.48239,Q9JVT5_NEIMA/3-122:0.56967):0.11629):0.14280,Q8Y9K9_LISMO/3-121:0.24141):0.53477,(Q8XFH2_RALSO/4-119:0.49109,Q8P6U4_XANCP/3-115:0.37369):0.04911):0.13525,Q8U4U8_AGRT5/21-135:0.39597,Q98F54_RHILO/3-115:0.18758);
RTP  ((((((((Q8DUJ8_STRMU/3-116,Q8NY56_STAAW/3-119),YPAA_LACLA/3-119),(Q8DWT0_STRA5/3-118,Q97NG8_STRPN/3-115)),Q8NL72_CORGL/3-124),(Q88ZG4_LACPL/3-121,Q9JVT5_NEIMA/3-122)),Q8Y9K9_LISMO/3-121),(Q8XFH2_RALSO/4-119,Q8P6U4_XANCP/3-115)),Q8U4U8_AGRT5/21-135,Q98F54_RHILO/3-115);
RTL  7.49082
LNK  Q88ZG4_LACPL/3-121:Q88ZG4:AL935252
LNK  Q8DUJ8_STRMU/3-116:Q8DUJ8:AE014933
LNK  Q8DWT0_STRA5/3-118:Q8DWT0:AE014288
LNK  Q8NL72_CORGL/3-124:Q8NL72:BA000036
LNK  Q8NY56_STAAW/3-119:Q8NY56:BA000033
LNK  Q8P6U4_XANCP/3-115:Q8P6U4:AE012400
LNK  Q8U4U8_AGRT5/21-135:Q8U4U8:AE008360
LNK  Q8XFH2_RALSO/4-119:Q8XFH2:AL646084
LNK  Q8Y9K9_LISMO/3-121:Q8Y9K9:AL591975
LNK  Q97NG8_STRPN/3-115:Q97NG8:AE007494
LNK  Q98F54_RHILO/3-115:Q98F54:BA000012
LNK  Q9JVT5_NEIMA/3-122:Q9JVT5:AL162754
LNK  YPAA_LACLA/3-119:Q02009:M87483
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9JVT5_NEIMA/3-122
ASQ  LLFIPLVLFVAVEHFYIAWLEMTQIPSEKAAETFKLPYEFMEQNRVQTLFGNQGLYNGFLGIGLVWSRFAAPDNAVYGATVLFLG----FVLIAAAWGAFSSGNKGILVKQGLPAFLAAAAVLA
DSQ  CTCCTCTTCATCCCCCTAGTCCTCTTCGTCGCCGTCGAACATTTCTACATCGCCTGGCTTGAAATGACGCAGATTCCCAGCGAAAAAGCGGCGGAAACGTTCAAGCTGCCTTATGAATTTATGGAACAAAATCGCGTGCAGACCCTGTTCGGCAACCAAGGGCTGTATAACGGCTTTCTCGGCATCGGGCTGGTGTGGTCGCGGTTTGCCGCTCCGGATAACGCGGTGTACGGCGCAACGGTACTGTTTCTCGGC------------TTCGTCCTGATTGCCGCCGCGTGGGGCGCGTTCTCTTCCGGCAACAAAGGCATACTCGTCAAACAAGGTTTGCCCGCATTTTTGGCAGCGGCGGCGGTGTTGGCG
TRN  10010101100011011
NAM  Q8Y9K9_LISMO/3-121
ASQ  ILAFILTFIVMIEHIYIMILEMFFANTKLAAKTFGVEKELLANKKVQTLFANQGLYNGFLAAGLVWGLFFAGAGFAETVQIFFLS----CVVVAALFGGATS-SKGILVKQGLPAVLALVAVLL
DSQ  ATTTTAGCATTTATTTTAACCTTCATCGTAATGATCGAGCATATTTATATAATGATTTTAGAAATGTTTTTCGCCAATACCAAACTCGCAGCCAAGACATTTGGTGTGGAGAAGGAACTACTTGCGAATAAGAAAGTACAGACGCTATTTGCGAATCAAGGGCTTTATAATGGCTTTCTTGCGGCAGGACTTGTGTGGGGATTGTTTTTCGCGGGAGCAGGGTTTGCTGAAACTGTGCAGATTTTCTTTTTGAGC------------TGTGTGGTTGTGGCGGCGCTGTTTGGAGGGGCGACTTCT---TCTAAGGGGATTTTGGTGAAACAGGGCTTGCCGGCGGTTTTGGCGTTGGTTGCGGTTTTGTTG
TRN  10010101100011010
NAM  Q88ZG4_LACPL/3-121
ASQ  VAAMIMAILVAVEHLFILWLEMFNADSEMAAKAFGIPRQTLQSPSVQLLFKNQGLYNGFLAVGILYSLFVIPAVASAGATLFFLA----CVMVAAVYGSITV-SRAIVVIQGLPALIAFILMYF
DSQ  GTTGCAGCAATGATTATGGCGATCTTGGTTGCCGTTGAACATTTATTTATTTTGTGGCTGGAAATGTTTAATGCGGATAGTGAAATGGCCGCAAAAGCGTTTGGAATTCCACGGCAAACGCTACAGTCGCCGTCAGTGCAATTATTGTTTAAAAATCAAGGGTTATATAACGGTTTCTTGGCCGTCGGTATTTTATACAGCTTGTTTGTGATTCCGGCCGTCGCGAGCGCCGGTGCAACCCTGTTTTTCTTAGCC------------TGTGTGATGGTTGCCGCGGTTTATGGTAGTATTACTGTC---AGTCGCGCGATCGTCGTGATTCAGGGGCTACCGGCATTAATTGCGTTTATTCTGATGTATTTT
TRN  11011101101011000
NAM  Q98F54_RHILO/3-115
ASQ  --GNILVGLVALIHVYIVYLEMVLWDTPRGHKAFRLTPEFAKASKV--LAANQGLYNGFLAAGLIWGLYLGAT--GFQVKVFFLL----CVAIAGLYGAATV-GRKILFIQTVPAVVALIAVWL
DSQ  ------GGCAACATCCTGGTCGGGCTGGTGGCCTTGATCCACGTCTACATCGTCTATCTCGAGATGGTGCTGTGGGACACGCCGCGCGGGCACAAGGCATTCCGCCTGACGCCGGAATTCGCCAAGGCGTCGAAGGTG------CTGGCCGCCAATCAGGGCCTCTACAACGGATTTCTTGCCGCCGGCCTGATCTGGGGGCTCTACCTCGGCGCCACC------GGTTTTCAGGTCAAGGTGTTCTTCCTGTTG------------TGCGTCGCCATTGCCGGCCTTTACGGCGCGGCGACGGTC---GGCCGCAAGATCCTGTTCATCCAGACCGTGCCGGCGGTGGTCGCCCTGATCGCGGTCTGGCTT
TRN  11011111101111111
NAM  Q8U4U8_AGRT5/21-135
ASQ  MIASILIAVVAAIHIYIVILEMLLWEKPAGRKAFGLSADFARQTKV--LAANQGLYNGFLAAGLIYGLTQGDE--GLSFKVFFLL----CVLVAGIFGAVTA-NMKILFIQALPALFALGFLWI
DSQ  ATGATCGCCAGCATTCTGATTGCCGTGGTTGCGGCCATCCATATCTACATCGTCATCCTGGAAATGCTGCTGTGGGAAAAACCGGCCGGCCGCAAGGCCTTCGGTCTCTCGGCGGATTTTGCCCGGCAGACGAAAGTG------CTCGCCGCCAATCAGGGGCTTTATAACGGGTTTCTGGCGGCCGGGCTGATCTATGGGCTCACACAGGGCGATGAA------GGGCTGAGCTTCAAGGTGTTTTTCCTGCTG------------TGTGTCCTGGTGGCCGGTATTTTCGGCGCCGTTACCGCC---AATATGAAGATCCTGTTCATTCAGGCACTGCCAGCCTTGTTTGCACTCGGATTTCTCTGGATC
TRN  11011101101011011
NAM  Q8P6U4_XANCP/3-115
ASQ  IVAIVAGLCVALLHVYILVLEMVLWTRPLGLKTFRNTPEKAQATRV--LAANQGLYNGFLAAGLFWGALQART----DVLGFFLG----CVVVAGCYGAYSV-NRRIFFVQALPALIALALLWL
DSQ  ATCGTTGCCATCGTTGCCGGCCTGTGTGTTGCGCTGCTGCACGTCTACATCCTGGTCCTGGAGATGGTGCTGTGGACGCGCCCACTGGGCCTGAAGACGTTCCGCAACACGCCGGAGAAGGCACAGGCCACCCGCGTG------CTCGCGGCCAACCAAGGGCTCTACAACGGCTTCCTTGCCGCCGGCCTGTTCTGGGGCGCGCTGCAGGCCCGCACC------------GACGTGCTGGGCTTCTTCCTGGGC------------TGCGTGGTGGTGGCGGGCTGCTACGGCGCCTACAGCGTC---AATCGCCGCATCTTCTTCGTGCAGGCGTTGCCGGCGCTGATTGCATTGGCACTGCTGTGGTTG
TRN  11011111101111111
NAM  Q8XFH2_RALSO/4-119
ASQ  NLALIAYLLVLLIHVYIVVLEMVLWKT-RGPKVFRITPEKAAETAA--MASNQGLYNGFLVAALVIGLVAPDPTIDAAFALFGLI----CVAVAGIWGGITV-NRRIVLVQTVPAVAALVLGWF
DSQ  AACCTCGCCCTCATCGCTTACCTGCTGGTGCTGCTGATCCACGTCTACATCGTCGTGCTCGAAATGGTGCTGTGGAAAACG---CGCGGGCCCAAGGTGTTCCGCATCACGCCGGAGAAAGCCGCCGAGACCGCCGCG------ATGGCCTCCAACCAGGGGCTGTACAACGGCTTCCTGGTGGCGGCGCTGGTGATCGGGCTGGTGGCGCCGGATCCGACCATCGATGCGGCGTTCGCGCTGTTCGGGCTGATC------------TGCGTGGCCGTCGCCGGCATCTGGGGCGGGATCACGGTG---AACCGGCGGATCGTGCTGGTGCAGACGGTGCCGGCGGTGGCGGCGCTGGTGCTGGGGTGGTTT
TRN  11011101101011011
NAM  Q97NG8_STRPN/3-115
ASQ  ---IILTTIVALEHFYIFYLESIATQSDATSRVFNMEKEELAHPSVSSLFKNQGIYKALLGVFLLYVIYFSQ---NLEIVTIFVL----FVIGAATYGSLTA-DKKIILKQGGSAILALISILL
DSQ  ---------ATTATTTTAACAACGATCGTTGCTTTGGAGCATTTTTACATTTTTTATTTGGAAAGTATTGCCACGCAATCAGATGCGACTAGTCGTGTATTTAATATGGAAAAGGAAGAATTGGCTCATCCGTCAGTAAGTTCATTGTTCAAAAATCAAGGAATTTATAAGGCTCTGCTAGGAGTCTTTCTCTTGTATGTCATTTATTTCTCACAG---------AATTTAGAAATTGTGACTATTTTTGTCTTA------------TTTGTGATTGGTGCTGCGACTTACGGCTCTTTAACAGCG---GATAAAAAAATTATTTTGAAACAAGGTGGATCAGCTATTTTGGCCTTGATTAGTATTTTACTC
TRN  11011101101011000
NAM  YPAA_LACLA/3-119
ASQ  ILTIILSLLVALEFFYIMYLETFATSSKTTSRVFNMGKEELERSSVQTLFKNQGIYNGLIGLGLIYAIFFSSA--QLEIVRLLLI----YIILVALYGSLTS-NKKIILTQGGLAILALISSFF
DSQ  ATTTTAACAATTATTCTGTCGCTTTTGGTTGCTTTGGAATTTTTCTACATTATGTATTTAGAGACCTTTGCTACAAGCTCAAAAACAACCAGTCGTGTGTTTAATATGGGAAAAGAGGAGCTAGAACGTTCTTCAGTTCAAACGCTTTTTAAAAATCAAGGGATTTATAACGGTTTGATTGGTTTAGGATTAATTTATGCAATATTCTTTTCGTCAGCA------CAACTTGAAATTGTTAGATTACTACTTATT------------TATATTATTTTAGTGGCTTTGTATGGCTCTTTGACAAGT---AATAAAAAGATCATTCTCACCCAAGGTGGTTTAGCCATTTTAGCTCTAATTTCTTCATTTTTT
TRN  10010101100011000
NAM  Q8DWT0_STRA5/3-118
ASQ  TLTIIIATLTALEHFYIMYLETLATQSNMTGKIFSMSKEELSYLPVIKLFKNQGVYNGLIGLFLLYGLYISQ---NQEIVAVFLI----NVLLVAIYGALTV-DKKILLKQGGLPILALLTFLF
DSQ  ACTTTAACAATAATTATTGCAACATTAACTGCTTTGGAACATTTTTATATTATGTATTTGGAGACGTTAGCCACCCAGTCAAATATGACTGGGAAGATTTTTAGTATGTCTAAAGAAGAGTTGTCATATTTACCCGTTATTAAACTTTTTAAGAATCAAGGTGTATACAACGGCTTGATTGGCCTATTCCTCCTTTATGGGTTATATATTTCACAG---------AATCAAGAAATTGTAGCTGTTTTTTTAATC------------AATGTATTGCTAGTTGCTATTTATGGTGCTTTGACAGTT---GATAAAAAAATCTTATTAAAACAGGGTGGTTTACCTATATTAGCTCTTTTAACATTCTTATTT
TRN  10010101110011000
NAM  Q8DUJ8_STRMU/3-116
ASQ  IIKMLIIILVALEFFYIMYLETLATQSTKTSQVFGMTQETLGEKEIDVLFKNQGIYNGLLGLGLLYGLAF-----NTAIILPILI----YIILVAAYGAYSS-NPKILLTQGGLAIIAALLYLF
DSQ  ATTATTAAAATGCTTATTATCATTCTGGTCGCTTTGGAATTCTTTTACATTATGTATTTGGAAACGTTAGCCACACAGTCTACAAAGACATCTCAAGTTTTTGGCATGACTCAAGAAACATTAGGTGAAAAAGAAATTGATGTCCTGTTTAAAAATCAAGGTATTTATAATGGCCTTCTTGGTTTAGGTCTGCTTTATGGCTTAGCTTTT---------------AATACAGCTATCATTTTACCAATCTTGATT------------TACATTATTCTTGTTGCTGCGTATGGTGCTTATAGCAGC---AATCCAAAAATTTTGCTGACACAGGGAGGGTTAGCCATTATCGCTGCACTGCTTTATCTCTTT
TRN  11011101101011010
NAM  Q8NY56_STAAW/3-119
ASQ  IISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKDKNINLLLKNQGVYNGLIGILLIYGLFISSN--PKEICAAILV----YIIGVAIYGGLSS-NISIFFKQGTLPVLALISMLW
DSQ  ATCATCTCAACAATTTTAATCATATTTGTGGCATTAGAGTTTTTCTATATTATGTACCTTGAAACGATTGCTACAACTTCCAAAAAGACTAGCGAGACATTTAATATAAGCGTCGATAAATTGAAAGACAAAAATATTAACCTACTTTTGAAGAACCAAGGCGTATATAACGGTTTAATCGGAATTTTGCTAATATACGGTTTGTTTATCAGCAGTAAT------CCAAAAGAAATATGCGCAGCTATTTTAGTG------------TATATCATTGGCGTTGCTATTTATGGTGGCCTTTCAAGC---AATATTAGTATCTTTTTCAAACAAGGTACATTGCCAGTATTGGCACTCATATCAATGCTTTGG
TRN  10010101110011000
NAM  Q8NL72_CORGL/3-124
ASQ  IIGAVFAILAVLLHVFIFYMESFAWTSEKARGVFGTTEIDAENTKE--MAYNQGFYNFFLAVIAGVGVAFLFAGSTGIGAALALAGTGSMLAAAAVLALSSPDKRGAAFKQGTFPLLAVVFLVI
DSQ  ATTATCGGAGCAGTTTTCGCCATCCTCGCAGTTCTACTGCATGTTTTCATCTTCTACATGGAATCATTCGCATGGACTAGTGAGAAAGCACGTGGAGTTTTCGGCACCACCGAAATCGACGCCGAGAACACCAAGGAG------ATGGCCTACAACCAAGGCTTCTACAACTTCTTCCTGGCAGTCATCGCCGGCGTGGGTGTTGCGTTCCTCTTCGCTGGTTCAACTGGCATCGGCGCAGCCCTCGCACTCGCTGGCACCGGTTCCATGCTGGCAGCCGCTGCAGTGTTGGCTTTGAGCTCACCCGACAAGCGTGGTGCAGCCTTCAAGCAAGGCACGTTCCCGCTGCTCGCAGTGGTGTTCCTTGTGATT
TRN  11011101101011001
//