EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06977 - SdiA-regulated)
FAM  PF06977
PID  SdiA-regulated
DES  SdiA-regulated
IPR  IPR009722
ANO  13
ALN  108
AID  0.364914
APH  ((Q9I294_PSEAE/158-261:0.53130,(Q87UK6_PSESM/165-269:0.29182,(Q88CM9_PSEPK/151-255:0.11069,Q9I6G4_PSEAE/169-273:0.15589):0.12243):0.20212):0.16763,(((Q87UK5_PSESM/170-267:0.19202,Q88CM8_PSEPK/166-263:0.24199):0.24963,Q9I6H2_PSEAE/177-275:0.16236):0.48855,(Q87TU0_PSESM/175-281:0.59626,Q9RBW0_9PSED/171-275:0.43086):0.26381):0.12748,(((Q04816_SALTY/154-253:1.03535,O52120_ECOLI/130-228:0.52996):0.13117,YJIK_ECOLI/177-277:0.75174):0.14373,Q8Z1N0_SALTI/158-254:0.61767):0.39563);
ATP  ((Q9I294_PSEAE/158-261,(Q87UK6_PSESM/165-269,(Q88CM9_PSEPK/151-255,Q9I6G4_PSEAE/169-273))),(((Q87UK5_PSESM/170-267,Q88CM8_PSEPK/166-263),Q9I6H2_PSEAE/177-275),(Q87TU0_PSESM/175-281,Q9RBW0_9PSED/171-275)),(((Q04816_SALTY/154-253,O52120_ECOLI/130-228),YJIK_ECOLI/177-277),Q8Z1N0_SALTI/158-254));
ATL  7.94009
DNO  13
DLN  324
DID  0.479513
DPH  (((Q9I6H2_PSEAE/177-275:0.11185,(Q88CM8_PSEPK/166-263:0.18811,Q87UK5_PSESM/170-267:0.17425):0.13107):0.24986,((((Q9I6G4_PSEAE/169-273:0.13423,Q88CM9_PSEPK/151-255:0.18026):0.10231,Q87UK6_PSESM/165-269:0.24404):0.08432,Q9I294_PSEAE/158-261:0.27875):0.10050,((YJIK_ECOLI/177-277:0.39852,(O52120_ECOLI/130-228:0.45041,Q8Z1N0_SALTI/158-254:0.43923):0.09981):0.17925,Q04816_SALTY/154-253:0.48490):0.24336):0.06289):0.10990,Q87TU0_PSESM/175-281:0.42537,Q9RBW0_9PSED/171-275:0.39545);
DTP  (((Q9I6H2_PSEAE/177-275,(Q88CM8_PSEPK/166-263,Q87UK5_PSESM/170-267)),((((Q9I6G4_PSEAE/169-273,Q88CM9_PSEPK/151-255),Q87UK6_PSESM/165-269),Q9I294_PSEAE/158-261),((YJIK_ECOLI/177-277,(O52120_ECOLI/130-228,Q8Z1N0_SALTI/158-254)),Q04816_SALTY/154-253))),Q87TU0_PSESM/175-281,Q9RBW0_9PSED/171-275);
DTL  5.26863
RID  0.364914
RPH  ((Q9I294_PSEAE/158-261:0.53130,(Q87UK6_PSESM/165-269:0.29182,(Q88CM9_PSEPK/151-255:0.11069,Q9I6G4_PSEAE/169-273:0.15589):0.12243):0.20212):0.16763,(((Q87UK5_PSESM/170-267:0.19202,Q88CM8_PSEPK/166-263:0.24199):0.24963,Q9I6H2_PSEAE/177-275:0.16236):0.48855,(Q87TU0_PSESM/175-281:0.59626,Q9RBW0_9PSED/171-275:0.43086):0.26381):0.12748,(((Q04816_SALTY/154-253:1.03535,O52120_ECOLI/130-228:0.52996):0.13117,YJIK_ECOLI/177-277:0.75174):0.14373,Q8Z1N0_SALTI/158-254:0.61767):0.39563);
RTP  ((Q9I294_PSEAE/158-261,(Q87UK6_PSESM/165-269,(Q88CM9_PSEPK/151-255,Q9I6G4_PSEAE/169-273))),(((Q87UK5_PSESM/170-267,Q88CM8_PSEPK/166-263),Q9I6H2_PSEAE/177-275),(Q87TU0_PSESM/175-281,Q9RBW0_9PSED/171-275)),(((Q04816_SALTY/154-253,O52120_ECOLI/130-228),YJIK_ECOLI/177-277),Q8Z1N0_SALTI/158-254));
RTL  7.94009
LNK  O52120_ECOLI/130-228:O52120:AF022236
LNK  Q04816_SALTY/154-253:Q04816:L08613
LNK  Q87TU0_PSESM/175-281:Q87TU0:AE016876
LNK  Q87UK5_PSESM/170-267:Q87UK5:AE016875
LNK  Q87UK6_PSESM/165-269:Q87UK6:AE016875
LNK  Q88CM8_PSEPK/166-263:Q88CM8:AE016793
LNK  Q88CM9_PSEPK/151-255:Q88CM9:AE016793
LNK  Q8Z1N0_SALTI/158-254:Q8Z1N0:AL627282
LNK  Q9I294_PSEAE/158-261:Q9I294:AE004628
LNK  Q9I6G4_PSEAE/169-273:Q9I6G4:AE004470
LNK  Q9I6H2_PSEAE/177-275:Q9I6H2:AE004470
LNK  Q9RBW0_9PSED/171-275:Q9RBW0:AF157797
LNK  YJIK_ECOLI/177-277:P39382:U14003
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxx
NAM  Q9RBW0_9PSED/171-275
ASQ  ALTLALG-KEDNKGLEGLAYDLKGDRLFVTKERDPRQLLEVSGLRASLEGGVSLH.VRDMSNLVKDKVFATDLSSVVFDQQSGHLILLSDESKLLIEMTD.EGKVVSF
DSQ  GCGCTAACCTTGGCGCTTGGC---AAGGAGGACAACAAAGGCCTTGAAGGGCTCGCCTACGACCTAAAAGGTGATCGTTTGTTTGTGACCAAGGAGCGTGACCCCCGGCAATTACTGGAAGTGAGCGGCCTTCGTGCCAGCCTGGAAGGAGGCGTTTCCCTGCAC...GTCCGCGACATGTCCAACCTAGTAAAAGACAAGGTGTTTGCCACTGACTTGTCTTCGGTTGTATTCGATCAACAGAGCGGCCATCTGATCCTGCTCAGCGACGAGTCGAAACTGCTGATTGAAATGACCGAC...GAGGGCAAGGTGGTGAGTTTC
TRN  11011101101011010
NAM  Q87TU0_PSESM/175-281
ASQ  YIALVINPSLHNKGFEGVTYDPANDRLFAIKERDPRQLFEVSGVLRSIDQHRLQIkVVDRLDWITESVATRDLSDGHYDQRTGHLLLLSDQSRSITELDG.NGRFVSI
DSQ  TATATTGCGTTGGTGATCAATCCGAGCCTTCATAACAAGGGCTTCGAGGGGGTGACTTACGATCCGGCTAACGACCGTTTATTCGCAATCAAGGAGCGCGATCCACGCCAGCTGTTCGAGGTCTCAGGCGTCTTGCGGTCCATCGATCAACATCGTTTGCAGATCaagGTCGTGGATCGGCTGGACTGGATTACAGAGAGTGTTGCGACACGCGACCTTTCGGACGGCCACTACGATCAGCGCACCGGACACTTGCTGCTGCTCAGTGACCAGTCACGCTCGATTACCGAGCTGGACGGC...AATGGCCGGTTCGTCAGCATA
TRN  10010111100111000
NAM  Q9I6G4_PSEAE/169-273
ASQ  QLSLGIG-LNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADKPFAV.HVVDDPGRDKRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDT.DGEPVST
DSQ  CAGCTTTCGCTGGGTATCGGC---CTCAACGGCAACAAGGGTTTCGAAGGGCTAGCTTACGACGCCGAGGGCAAGCGCCTGTTCGTCGCCAAGGAGCGTGACCCGGTGCGCATCTACGAGATCCACGGTTTCCCCCACACCCAGGCGGACAAACCGTTCGCCGTG...CACGTGGTGGACGACCCCGGGCGCGACAAGCGCCTGTTCGTCCGCGACCTGTCCAGTCTGCAGTTCGACGAGGGCACCGGGCACCTGCTGGCGTTGTCCGACGAGTCGCGTCTGGTAGTCGAGCTGGACACC...GACGGCGAGCCGGTCAGCACC
TRN  11011101101011011
NAM  Q88CM9_PSEPK/151-255
ASQ  QLTLGIG-LNGNKGFEGLAYDSAGKRLFVAKERDPMLIYEVHGFPHDNPEKPYAV.HVVQDRKRDSRLFVRDLSSLQFDERSGHLLALSDESRLVLELDV.QGQPLST
DSQ  CAGCTGACGTTGGGTATTGGC---CTCAATGGCAACAAAGGCTTCGAGGGCCTGGCGTACGATTCGGCGGGCAAGCGCCTGTTCGTGGCGAAGGAGCGTGACCCGATGCTGATCTATGAGGTGCATGGCTTCCCGCATGACAATCCGGAAAAGCCCTACGCCGTG...CATGTGGTGCAGGACCGCAAGCGCGATTCACGGTTGTTTGTGCGGGATTTGTCGAGCTTGCAGTTCGATGAACGCAGTGGGCATTTGCTGGCATTGTCGGACGAGTCGCGGTTGGTGCTGGAGCTGGATGTA...CAGGGCCAGCCGCTGAGTACC
TRN  11011101101011001
NAM  Q87UK6_PSESM/165-269
ASQ  QLTLGLT-ASGNKGYEGLAYDSRGKRLFVARERDPVQIIEVRGFPRVNADAPGNL.QVITDGKRDGKLSVRDLSSLQFDEVSGHLLALSDESKRILELDT.TGRPIGS
DSQ  CAGCTGACGCTGGGGCTGACG---GCCAGCGGCAACAAGGGCTACGAAGGGCTGGCCTATGATTCGCGTGGCAAGCGCCTGTTTGTCGCCCGCGAGCGCGATCCGGTGCAGATCATCGAGGTGCGTGGCTTTCCCCGAGTCAATGCCGATGCGCCGGGCAATCTT...CAGGTCATCACCGACGGCAAGCGCGACGGCAAGCTTTCCGTGCGTGATCTTTCCAGCCTGCAATTCGATGAAGTGAGCGGTCACCTGCTGGCGCTGTCCGATGAGTCGAAACGGATTCTGGAACTCGACACC...ACGGGGCGGCCGATTGGCAGT
TRN  11011101101011011
NAM  Q9I294_PSEAE/158-261
ASQ  KFSLG-SANKRNKGFEGLAYDPLRERLFVAREKAPVGIIEVNGFFNDRGEALDLS.-VGGDPQRDRGLFLTDLSSLYYDKASDHLLVLSDESRVVIELDR.AGDPLGS
DSQ  AAGTTCTCCCTGGGC---AGTGCAAACAAGCGCAACAAGGGCTTCGAGGGGTTGGCCTACGACCCGCTGCGCGAGCGCCTGTTCGTGGCCCGGGAAAAGGCGCCGGTGGGCATCATCGAGGTAAACGGCTTCTTCAACGACCGCGGCGAGGCGCTCGACCTGAGC...---GTCGGCGGCGACCCGCAGCGCGATCGCGGGTTGTTCCTCACCGATCTGTCGAGCCTCTACTACGACAAGGCCAGCGATCACCTGCTGGTGCTTTCCGACGAGTCGCGGGTGGTCATCGAACTGGATCGC...GCCGGGGATCCGCTCGGCAGC
TRN  11011111101111111
NAM  Q9I6H2_PSEAE/177-275
ASQ  EFPLG-NIGKKNKGFEGIAWDPRQQRLLLSKERDPMTLFSWK-----SDGGPSLS.-GAMTALPSDDLYMRNVSALSVDPRTGHTLVLSAESHLLLELDE.KGEPVSF
DSQ  GAATTCCCGCTGGGC---AATATTGGCAAGAAGAACAAGGGCTTCGAGGGCATCGCCTGGGATCCGCGCCAGCAGCGTCTGTTGCTGAGCAAGGAGCGCGATCCGATGACCCTGTTCAGCTGGAAG---------------AGCGACGGCGGGCCGAGCCTGAGC...---GGGGCGATGACCGCGCTACCGAGCGACGACCTGTACATGCGCAACGTCTCGGCCCTCAGCGTCGACCCGCGTACCGGCCATACCCTGGTGCTGTCGGCCGAATCGCATCTGCTGCTGGAGCTGGACGAG...AAGGGCGAGCCGGTCAGCTTC
TRN  11011111101111111
NAM  Q88CM8_PSEPK/166-263
ASQ  SYDLG-PSVKSNKGFEAIAWDPLRQRLIIGEERPP-KLYTWNTDGRSPLK-----.-GEKQPLPSDELDLRNLSALGVDPRTGHLLVLSADSNMLLELDE.QGQQVSF
DSQ  AGCTACGACCTGGGC---CCGTCGGTCAAGAGCAACAAGGGCTTCGAGGCCATTGCCTGGGACCCGCTGCGCCAGCGCCTGATCATTGGCGAGGAGCGCCCGCCC---AAGCTGTACACCTGGAACACCGATGGCCGCAGCCCGCTCAAG---------------...---GGTGAGAAGCAGCCGTTGCCTAGCGATGAACTCGACTTGCGCAACCTGTCTGCGCTGGGTGTCGACCCGCGTACTGGCCACTTGCTGGTGCTATCGGCCGACTCCAACATGCTGCTGGAGCTGGACGAG...CAGGGCCAGCAAGTCAGCTTC
TRN  11011111101111111
NAM  Q87UK5_PSESM/170-267
ASQ  HYELG-TSANKNKGFEGVAWDPRRQQLLLGEERPPA-LYTWK-----SDGSNVLK.-GDKQSLLSRALDMRNLSSLSIDPRTGHMLALSADSHMLLEVDE.QGNQVSF
DSQ  CACTACGAGCTGGGC---ACGTCGGCCAACAAGAACAAGGGTTTCGAGGGCGTCGCCTGGGACCCGCGTCGTCAGCAACTGCTGCTGGGCGAAGAGCGTCCGCCAGCG---TTGTACACCTGGAAG---------------AGCGACGGCAGCAACGTGCTCAAG...---GGCGACAAGCAGAGCCTTTTGAGTCGCGCTCTGGACATGCGCAACCTGTCGTCACTGAGCATCGATCCGCGCACCGGCCACATGCTGGCGCTTTCAGCAGATTCGCACATGCTGCTGGAAGTGGACGAG...CAGGGTAATCAGGTCAGCTTC
TRN  11011111101111101
NAM  Q8Z1N0_SALTI/158-254
ASQ  MVKLEGYDKAKNKGLEGTAWDAKNERLYAAKERKPIMIKEVE---MSKNG-----.-ITRALPSAITASVSDVSGLEYHAPTDSLLVLSDESKMILEVSS.EWRVRDR
DSQ  ATGGTGAAGCTTGAGGGCTATGACAAAGCAAAAAATAAAGGGCTGGAAGGTACGGCATGGGATGCGAAAAATGAGAGATTATATGCCGCAAAAGAAAGAAAACCCATTATGATCAAAGAAGTAGAG---------ATGAGCAAAAATGGT---------------...---ATCACCAGAGCGTTGCCTTCTGCCATCACTGCGAGTGTGAGCGATGTCTCCGGACTTGAATACCATGCCCCAACGGATTCGCTGCTGGTGTTGTCGGACGAGTCAAAAATGATTCTGGAGGTCAGTTCC...GAGTGGCGGGTGCGCGATCGA
TRN  10010101100011000
NAM  O52120_ECOLI/130-228
ASQ  KIQLE-KFNKKNRGFEGLAWKADDRMLFVAKERRPSKIFIYQ---LSSDLLSVKQ.-ATIPE-ALNDIRVNDISGLAFN--NESLMILSDESRKLLKFNLtEMSFIEM
DSQ  AAAATTCAGTTAGAA---AAATTCAATAAAAAGAATAGAGGGTTTGAAGGGCTGGCATGGAAAGCAGATGATCGGATGCTGTTTGTCGCAAAAGAAAGACGCCCAAGTAAAATATTTATATATCAA---------CTTTCTTCAGACCTGCTGAGTGTAAAGCAA...---GCAACTATTCCAGAG---GCACTAAATGATATACGTGTTAACGATATATCCGGCCTGGCCTTTAAT------AATGAAAGTCTGATGATTCTGTCCGATGAATCGCGTAAATTACTCAAGTTTAACCTGacaGAGATGTCTTTCATTGAGATG
TRN  10010101100011000
NAM  YJIK_ECOLI/177-277
ASQ  KIKIPLQDSPTNCGFEGLAYSRQDHTFWFFKEKNPIEVYKVNGLLSSNEL-----.HISKDEALQRQFTLDDVSGAEFNQQKNTLLVLSHESRALQEVTL.VGEVIGE
DSQ  AAAATAAAAATCCCGCTGCAAGACTCCCCAACCAATTGCGGTTTTGAAGGGTTGGCTTATTCTCGCCAGGATCACACTTTCTGGTTTTTTAAAGAGAAAAATCCGATTGAGGTCTACAAAGTTAACGGGCTGTTAAGTAGCAATGAATTA---------------...CACATCAGCAAAGACGAGGCACTACAACGGCAATTTACTTTAGATGATGTGTCCGGCGCAGAATTTAACCAGCAAAAAAATACGCTTCTGGTGCTGTCTCATGAATCTCGCGCACTCCAGGAAGTAACCCTG...GTTGGCGAGGTTATCGGTGAA
TRN  10010101100011010
NAM  Q04816_SALTY/154-253
ASQ  SLTLDVNRHSDNAGFEGLARGRGEHALMVAQEKKPLRLYVTD---RSPDALSMSD.-SLTHR-ASLPWFLKDISGLHYDRNNGLLYVLSHESAVVVVSGL.DGG-RKV
DSQ  AGCCTGACGCTGGATGTGAACAGGCACAGCGACAATGCCGGTTTTGAAGGCCTTGCCCGGGGACGGGGAGAGCATGCCCTGATGGTGGCGCAGGAGAAAAAACCGCTGCGGCTTTACGTGACGGAC---------CGGAGCCCTGATGCGCTGTCGATGAGTGAC...---TCGCTGACACACCGG---GCGTCCCTGCCATGGTTCCTGAAGGATATCTCCGGTCTGCATTATGACCGGAACAACGGGCTCCTGTATGTACTTTCCCATGAGTCTGCCGTGGTCGTGGTGTCGGGCCTG...GACGGCGGG---AGGAAAGTG
TRN  10010101100011011
//