EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06967 - Mo-nitro_C)
FAM  PF06967
PID  Mo-nitro_C
DES  Mo-dependent nitrogenase C-terminus
IPR  IPR009717
ANO  13
ALN  84
AID  0.589772
APH  (((((Q8YWA2_ANASP/32-115:0.22936,(((Q8DHU3_SYNEL/20-103:0.46276,Q8YLB2_ANASP/12-95:0.29357):0.15831,((P73342_SYNY3/139-222:0.21072,Q8YQT1_ANASP/141-224:0.11084):0.09419,Q8DIL9_SYNEL/144-227:0.06600):0.09367):0.09618,Q8YLX6_ANASP/15-98:0.35732):0.04931):0.06901,Q8YYS3_ANASP/12-95:0.12636):0.09623,(Q8DJ93_SYNEL/13-95:0.37184,Q8YQY3_ANASP/42-125:0.06601):0.09505):0.18778,Q44487_ANAVA/12-94:0.24366):0.02214,Q44143_ANASP/25-107:0.13363,Q47920_FISSU/25-107:0.16255);
ATP  (((((Q8YWA2_ANASP/32-115,(((Q8DHU3_SYNEL/20-103,Q8YLB2_ANASP/12-95),((P73342_SYNY3/139-222,Q8YQT1_ANASP/141-224),Q8DIL9_SYNEL/144-227)),Q8YLX6_ANASP/15-98)),Q8YYS3_ANASP/12-95),(Q8DJ93_SYNEL/13-95,Q8YQY3_ANASP/42-125)),Q44487_ANAVA/12-94),Q44143_ANASP/25-107,Q47920_FISSU/25-107);
ATL  3.80752
DNO  13
DLN  252
DID  0.597689
DPH  ((((Q8YWA2_ANASP/32-115:0.22364,((Q8DHU3_SYNEL/20-103:0.41627,Q8DJ93_SYNEL/13-95:0.31031):0.10336,((P73342_SYNY3/139-222:0.22602,Q8YQT1_ANASP/141-224:0.13475):0.08775,Q8DIL9_SYNEL/144-227:0.11401):0.06860):0.09713):0.08095,((Q8YYS3_ANASP/12-95:0.15788,(Q8YLB2_ANASP/12-95:0.36041,Q8YLX6_ANASP/15-98:0.25752):0.14163):0.08669,Q8YQY3_ANASP/42-125:0.28627):0.05029):0.15944,Q44143_ANASP/25-107:0.11850):0.02419,Q44487_ANAVA/12-94:0.32951,Q47920_FISSU/25-107:0.15738);
DTP  ((((Q8YWA2_ANASP/32-115,((Q8DHU3_SYNEL/20-103,Q8DJ93_SYNEL/13-95),((P73342_SYNY3/139-222,Q8YQT1_ANASP/141-224),Q8DIL9_SYNEL/144-227))),((Q8YYS3_ANASP/12-95,(Q8YLB2_ANASP/12-95,Q8YLX6_ANASP/15-98)),Q8YQY3_ANASP/42-125)),Q44143_ANASP/25-107),Q44487_ANAVA/12-94,Q47920_FISSU/25-107);
DTL  3.91049
RID  0.589772
RPH  (((((Q8YWA2_ANASP/32-115:0.22936,(((Q8DHU3_SYNEL/20-103:0.46276,Q8YLB2_ANASP/12-95:0.29357):0.15831,((P73342_SYNY3/139-222:0.21072,Q8YQT1_ANASP/141-224:0.11084):0.09419,Q8DIL9_SYNEL/144-227:0.06600):0.09367):0.09618,Q8YLX6_ANASP/15-98:0.35732):0.04931):0.06901,Q8YYS3_ANASP/12-95:0.12636):0.09623,(Q8DJ93_SYNEL/13-95:0.37184,Q8YQY3_ANASP/42-125:0.06601):0.09505):0.18778,Q44487_ANAVA/12-94:0.24366):0.02214,Q44143_ANASP/25-107:0.13363,Q47920_FISSU/25-107:0.16255);
RTP  (((((Q8YWA2_ANASP/32-115,(((Q8DHU3_SYNEL/20-103,Q8YLB2_ANASP/12-95),((P73342_SYNY3/139-222,Q8YQT1_ANASP/141-224),Q8DIL9_SYNEL/144-227)),Q8YLX6_ANASP/15-98)),Q8YYS3_ANASP/12-95),(Q8DJ93_SYNEL/13-95,Q8YQY3_ANASP/42-125)),Q44487_ANAVA/12-94),Q44143_ANASP/25-107,Q47920_FISSU/25-107);
RTL  3.80752
LNK  P73342_SYNY3/139-222:P73342:BA000022
LNK  Q44143_ANASP/25-107:Q44143:U47055
LNK  Q44487_ANAVA/12-94:Q44487:U49859
LNK  Q47920_FISSU/25-107:Q47920:U49514
LNK  Q8DHU3_SYNEL/20-103:Q8DHU3:BA000039
LNK  Q8DIL9_SYNEL/144-227:Q8DIL9:BA000039
LNK  Q8DJ93_SYNEL/13-95:Q8DJ93:BA000039
LNK  Q8YLB2_ANASP/12-95:Q8YLB2:BA000020
LNK  Q8YLX6_ANASP/15-98:Q8YLX6:BA000019
LNK  Q8YQT1_ANASP/141-224:Q8YQT1:BA000019
LNK  Q8YQY3_ANASP/42-125:Q8YQY3:BA000019
LNK  Q8YWA2_ANASP/32-115:Q8YWA2:BA000019
LNK  Q8YYS3_ANASP/12-95:Q8YYS3:BA000019
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8YLX6_ANASP/15-98
ASQ  LLLQPIRQWLESLKIKNHRLARWLCTIIPASCPFEREFKWGDRILVHIPPLCKLNPFYEQLIEIRFKALMYLADECGEDVTQFC
DSQ  CTCCTACTACAACCAATCCGTCAATGGCTGGAATCTCTAAAAATCAAAAATCACCGATTAGCCCGGTGGCTGTGTACAATTATTCCTGCCAGTTGTCCATTTGAAAGAGAATTTAAATGGGGCGATCGCATCCTAGTTCACATCCCGCCTCTATGTAAACTCAATCCTTTCTACGAACAGTTAATAGAAATTCGCTTTAAAGCTTTAATGTACTTAGCAGACGAATGTGGTGAAGATGTCACACAGTTCTGT
TRN  10010101100011010
NAM  Q8YLB2_ANASP/12-95
ASQ  SLLNQLRYQLEVIEINDARIARFLCGLIPSHCPFERTVSILGRKVFQIPPLCKLNPFYEQIVLLRFKCLMYLADDCGEDVTKYC
DSQ  AGTTTATTAAACCAGTTAAGATATCAACTTGAAGTTATAGAAATCAATGATGCTAGAATAGCCAGATTCTTGTGTGGTTTGATTCCTTCTCATTGCCCATTTGAGAGAACTGTGTCTATTTTAGGACGAAAGGTATTTCAAATTCCACCTTTGTGTAAGTTAAACCCTTTTTATGAACAAATAGTTCTGCTTCGTTTTAAATGCTTGATGTATTTAGCAGATGACTGTGGTGAAGATGTAACTAAATACTGC
TRN  10010101100011010
NAM  Q8YYS3_ANASP/12-95
ASQ  DLLYPIRQWLGGIEIHNSKLAHLLCKLIPAQCPFERDVNLFGRILFHIPPMCKLNPLYEEVVGLRFKALCYLADECGEDITVYC
DSQ  GACTTACTATATCCTATCCGCCAATGGTTAGGAGGAATCGAAATTCATAACTCTAAACTAGCTCATCTGTTATGCAAACTTATCCCTGCTCAATGTCCATTTGAAAGAGACGTGAACCTATTTGGCCGTATATTGTTTCATATCCCGCCAATGTGTAAGTTAAATCCTTTATATGAGGAAGTTGTGGGCTTACGTTTCAAAGCCTTGTGTTACCTAGCTGATGAATGTGGAGAAGATATCACAGTTTATTGC
TRN  10010101100011010
NAM  Q8YQY3_ANASP/42-125
ASQ  DILRPLRRYLDSIEVSDRLLAHRLCQLIPAQCPFERDINLFGKTLLHIPPLCKLNPLYEEVVSLRFRALCYLADECGEDVSQYC
DSQ  GACATTCTCAGACCCTTAAGACGCTACTTAGACAGCATTGAAGTGAGCGATCGCTTATTGGCTCACCGCCTATGTCAACTAATTCCTGCTCAATGTCCTTTTGAACGCGACATCAATTTATTTGGCAAAACTCTGCTGCACATTCCGCCATTGTGTAAACTCAACCCTCTATATGAAGAAGTCGTTAGTTTGCGTTTCCGGGCGCTGTGCTATTTAGCTGATGAATGCGGCGAGGATGTATCACAGTATTGT
TRN  10010101100011000
NAM  Q8YWA2_ANASP/32-115
ASQ  DPLQPLRQWIDALEIQNRKLAHFIAKLIPAQCPFERDIVVFGRIIAHIPPMCKLNPLYDQFVGLRFRALCYLVDKCGEDIQSYC
DSQ  GATCCATTACAACCTTTACGTCAGTGGATTGATGCACTAGAAATACAAAATCGTAAGCTAGCTCACTTTATTGCAAAATTGATTCCTGCTCAGTGTCCTTTTGAGCGTGACATCGTGGTATTTGGTCGGATTATTGCCCATATTCCCCCCATGTGTAAGCTCAATCCCCTGTATGATCAATTTGTTGGTTTACGTTTTCGCGCTTTGTGTTATTTAGTAGATAAGTGTGGAGAAGATATCCAGTCTTACTGC
TRN  10010101100011010
NAM  Q8DJ93_SYNEL/13-95
ASQ  SILWPVRQWLEHLEVRDRQLAHRLCRLIPAQCPFERDIVV-AQWHIHIPPLCHLNPLYEELMLLRYRALCYLADECHEDISAYC
DSQ  AGCATCCTGTGGCCGGTACGGCAGTGGCTAGAGCATCTGGAAGTGCGCGATCGCCAGCTTGCCCATCGTCTGTGCCGCTTGATCCCGGCCCAGTGTCCCTTTGAACGCGATATTGTGGTT---GCCCAATGGCACATTCACATCCCACCCTTGTGCCACCTCAATCCCCTCTATGAGGAACTAATGCTCTTGCGCTACCGTGCCCTTTGCTACTTGGCGGATGAGTGCCATGAGGATATTAGTGCTTACTGT
TRN  11011111101111111
NAM  Q8YQT1_ANASP/141-224
ASQ  EVLDPLRHWLDGLDIQDPRVARFLCKMIPPQCPFERDVTLFGRKIVHIPPLCKINPLYEQLVGLRFRALSYLADECKEDVSPYI
DSQ  GAAGTACTTGACCCCCTGCGCCACTGGCTAGATGGCTTAGACATTCAAGACCCCAGAGTCGCCCGTTTCTTATGTAAAATGATTCCCCCCCAATGTCCCTTTGAACGGGATGTCACCCTATTCGGACGCAAAATTGTTCACATTCCCCCCTTATGTAAAATCAACCCATTGTATGAACAACTAGTAGGGTTACGTTTCCGCGCCCTCTCCTATTTGGCAGATGAATGTAAAGAGGACGTTTCGCCTTATATT
TRN  10010101100011010
NAM  Q8DIL9_SYNEL/144-227
ASQ  RLLDPVRHWLDGLEIKDAKVARFLCRLIPPQCPFERDIILFGRKIVHIPPLCKLNPLYDQLVGLRFRALTYLADECGEDITPYC
DSQ  CGCCTATTGGATCCCGTGCGCCATTGGCTGGATGGCTTAGAAATCAAAGATGCCAAGGTCGCTCGCTTTCTCTGCCGGCTGATTCCCCCCCAATGCCCCTTTGAGCGCGATATTATCCTCTTTGGTCGCAAGATTGTCCATATTCCCCCCCTCTGTAAACTCAATCCCCTTTATGATCAATTAGTGGGGTTGCGCTTCCGCGCGCTCACCTATTTGGCCGATGAGTGTGGTGAAGACATTACCCCCTACTGT
TRN  11011101101011010
NAM  P73342_SYNY3/139-222
ASQ  DLLHPVKDWLDGMAIHDPRLAHFICHLVPPQCPFERDVKLFGRKIVHIPPLCKLNPLYEQLIGLRFRALSYLADDCQEDITPYI
DSQ  GATTTACTTCACCCCGTCAAGGATTGGCTGGACGGCATGGCCATCCACGATCCTCGTTTGGCCCATTTCATTTGTCATCTGGTGCCCCCCCAATGTCCCTTCGAGCGGGATGTTAAACTGTTTGGGCGCAAAATTGTTCATATTCCCCCTCTGTGCAAACTAAATCCTCTGTATGAACAGTTAATTGGTCTGAGGTTCCGGGCCCTTTCCTACCTGGCCGATGACTGCCAAGAGGACATCACGCCCTATATT
TRN  10010101100011010
NAM  Q44487_ANAVA/12-94
ASQ  DILSPLRRWVDQIQVCDRRTAHLICRLIPCCCPFERTLTLLGHTI-HIPPLCKLNPLYDEFIALRFRSLSYLSDECGEDITRYI
DSQ  GATATTCTCTCCCCCCTACGCCGATGGGTAGATCAAATTCAAGTGTGCGATCGCCGTACCGCCCATCTAATTTGCCGCCTCATTCCCTGCTGCTGTCCCTTTGAACGAACCCTTACATTGCTGGGACACACCATC---CACATCCCCCCACTCTGCAAACTCAATCCCCTCTACGACGAATTTATAGCCTTACGCTTCCGCAGCCTCTCCTACCTCTCTGATGAATGCGGCGAAGATATCACCAGATACATC
TRN  10010101100011010
NAM  Q47920_FISSU/25-107
ASQ  DLLRPLRRLVDSIQIKNYRLAHLICQIIPCCCPFQRDIHLFGRI-FHVPALCKLNPLYDNFVGLRFRALSYLSDECGEDVSKYI
DSQ  GATCTTCTACGTCCATTACGTCGATTAGTAGATAGCATCCAAATCAAAAATTATCGTCTGGCTCATTTAATTTGCCAAATTATTCCTTGCTGTTGTCCTTTTCAGCGAGATATTCACTTGTTTGGGCGTATT---TTCCACGTTCCTGCGCTCTGTAAACTCAATCCTTTATATGATAATTTTGTAGGATTGCGTTTTCGAGCATTATCTTACCTCAGCGATGAATGTGGAGAAGATGTCTCGAAATATATT
TRN  11011101101011010
NAM  Q44143_ANASP/25-107
ASQ  DVLRPLRGWVDNFPVKNARFAHLVCQVIPCCCPFERDINLFGRTI-HIPAFCKLNPLYDEFVGLRFRALSYLADECGEDITKYI
DSQ  GATGTACTTCGTCCTTTGCGTGGTTGGGTTGATAATTTTCCGGTTAAAAATGCTCGTTTCGCTCATCTTGTTTGCCAGGTAATTCCTTGCTGTTGTCCTTTTGAGCGAGACATTAATTTATTTGGGCGGACGATC---CATATTCCAGCATTCTGTAAACTCAATCCTTTGTATGACGAATTTGTAGGATTGCGTTTTCGCGCTTTATCTTATCTAGCTGATGAATGTGGAGAGGATATCACAAAGTACATT
TRN  11011101111011010
NAM  Q8DHU3_SYNEL/20-103
ASQ  SLITKIRQWLMTYPITTPAIAHRICRWIPAQCPFARTFSLFGRPVITIPPLCKLNPFYEEVVMLRLRALTYLSDVCQEDISQYV
DSQ  TCTTTAATCACCAAAATCCGTCAATGGCTAATGACTTATCCAATTACGACGCCAGCGATCGCCCACCGCATTTGTCGCTGGATTCCTGCCCAATGTCCCTTTGCCCGCACCTTCTCCCTCTTTGGTCGGCCAGTCATTACCATTCCCCCCCTGTGTAAACTCAATCCCTTTTATGAGGAGGTGGTGATGCTGCGGTTGCGCGCCCTGACCTACCTCAGTGATGTCTGCCAAGAGGACATCAGTCAATACGTC
TRN  11011101101011010
//