EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06908 - DUF1273)
FAM  PF06908
PID  DUF1273
DES  Protein of unknown function (DUF1273)
IPR  IPR010697
ANO  12
ALN  178
AID  0.419906
APH  (((((((Q9CI21_LACLA/1-171:0.31960,Q8DR58_STRR6/1-171:0.38906):0.03180,Q8K6D7_STRP3/1-171:0.34551):0.11070,Q8E1Q3_STRA5/1-172:0.17961):0.12680,Q8DVL2_STRMU/1-171:0.14501):0.31153,Q88W96_LACPL/1-177:0.86419):0.15090,((YPSA_BACSU/1-177:0.31758,(Q8CUT2_OCEIH/1-174:0.53302,Q9KC06_BACHD/1-177:0.46132):0.07945):0.16809,Q8Y613_LISMO/1-176:0.40656):0.09952):0.44388,Q8CSJ2_STAEP/1-178:0.13814,Q99U41_STAAM/1-178:0.15445);
ATP  (((((((Q9CI21_LACLA/1-171,Q8DR58_STRR6/1-171),Q8K6D7_STRP3/1-171),Q8E1Q3_STRA5/1-172),Q8DVL2_STRMU/1-171),Q88W96_LACPL/1-177),((YPSA_BACSU/1-177,(Q8CUT2_OCEIH/1-174,Q9KC06_BACHD/1-177)),Q8Y613_LISMO/1-176)),Q8CSJ2_STAEP/1-178,Q99U41_STAAM/1-178);
ATL  5.77838
DNO  12
DLN  534
DID  0.534444
DPH  ((((Q8Y613_LISMO/1-176:0.33265,(YPSA_BACSU/1-177:0.24648,Q9KC06_BACHD/1-177:0.39456):0.08009):0.08896,(Q88W96_LACPL/1-177:0.60390,((((Q8DR58_STRR6/1-171:0.30421,Q8K6D7_STRP3/1-171:0.27078):0.05026,Q8E1Q3_STRA5/1-172:0.17301):0.06130,Q9CI21_LACLA/1-171:0.26702):0.08414,Q8DVL2_STRMU/1-171:0.15651):0.12248):0.09377):0.06799,Q8CUT2_OCEIH/1-174:0.38932):0.25390,Q8CSJ2_STAEP/1-178:0.14823,Q99U41_STAAM/1-178:0.14669);
DTP  ((((Q8Y613_LISMO/1-176,(YPSA_BACSU/1-177,Q9KC06_BACHD/1-177)),(Q88W96_LACPL/1-177,((((Q8DR58_STRR6/1-171,Q8K6D7_STRP3/1-171),Q8E1Q3_STRA5/1-172),Q9CI21_LACLA/1-171),Q8DVL2_STRMU/1-171))),Q8CUT2_OCEIH/1-174),Q8CSJ2_STAEP/1-178,Q99U41_STAAM/1-178);
DTL  4.34654
RID  0.419906
RPH  (((((((Q9CI21_LACLA/1-171:0.31960,Q8DR58_STRR6/1-171:0.38906):0.03180,Q8K6D7_STRP3/1-171:0.34551):0.11070,Q8E1Q3_STRA5/1-172:0.17961):0.12680,Q8DVL2_STRMU/1-171:0.14501):0.31153,Q88W96_LACPL/1-177:0.86419):0.15090,((YPSA_BACSU/1-177:0.31758,(Q8CUT2_OCEIH/1-174:0.53302,Q9KC06_BACHD/1-177:0.46132):0.07945):0.16809,Q8Y613_LISMO/1-176:0.40656):0.09952):0.44388,Q8CSJ2_STAEP/1-178:0.13814,Q99U41_STAAM/1-178:0.15445);
RTP  (((((((Q9CI21_LACLA/1-171,Q8DR58_STRR6/1-171),Q8K6D7_STRP3/1-171),Q8E1Q3_STRA5/1-172),Q8DVL2_STRMU/1-171),Q88W96_LACPL/1-177),((YPSA_BACSU/1-177,(Q8CUT2_OCEIH/1-174,Q9KC06_BACHD/1-177)),Q8Y613_LISMO/1-176)),Q8CSJ2_STAEP/1-178,Q99U41_STAAM/1-178);
RTL  5.77838
LNK  Q88W96_LACPL/1-177:Q88W96:AL935257
LNK  Q8CSJ2_STAEP/1-178:Q8CSJ2:AE016747
LNK  Q8CUT2_OCEIH/1-174:Q8CUT2:BA000028
LNK  Q8DR58_STRR6/1-171:Q8DR58:AE008414
LNK  Q8DVL2_STRMU/1-171:Q8DVL2:AE014893
LNK  Q8E1Q3_STRA5/1-172:Q8E1Q3:AE014205
LNK  Q8K6D7_STRP3/1-171:Q8K6D7:AE014163
LNK  Q8Y613_LISMO/1-176:Q8Y613:AL591981
LNK  Q99U41_STAAM/1-178:Q99U41:BA000017
LNK  Q9CI21_LACLA/1-171:Q9CI21:AE006288
LNK  Q9KC06_BACHD/1-177:Q9KC06:BA000004
LNK  YPSA_BACSU/1-177:P50838:L47838
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9KC06_BACHD/1-177
ASQ  M-KVITLTGYKAHELGIFSHNHRGITYIKKAFEQQILALIEEGVEWFLISGQLGVELWAAEVVIKLKQTHPHIQLAVLTPFLEQESQWQEASRKKYHDILEAADFVDSITKRPYEGPAQLRLKNEYLVQKSDGLLVLYDEDKPGSPSYYLEVAKKRQQQEPYDIRLITPHDLEWIAQE
DSQ  ATG---AAGGTCATTACACTTACTGGCTATAAAGCTCACGAGCTAGGGATTTTCTCCCATAACCATCGCGGCATTACATATATAAAAAAAGCCTTTGAACAACAGATCCTTGCCTTGATTGAAGAAGGGGTAGAGTGGTTTCTTATTAGCGGCCAGCTCGGAGTGGAATTATGGGCAGCCGAAGTCGTCATTAAGTTGAAACAAACTCATCCACACATTCAATTGGCCGTTTTGACTCCGTTTCTTGAGCAGGAATCCCAGTGGCAAGAGGCTTCTCGTAAAAAATATCATGACATTTTGGAGGCGGCTGACTTTGTGGACAGTATTACGAAGCGACCGTATGAAGGTCCTGCTCAGCTTCGTCTGAAAAATGAATATTTAGTGCAAAAGTCCGATGGTCTACTCGTTCTTTATGACGAAGACAAACCAGGTTCTCCAAGCTATTATTTAGAAGTTGCAAAAAAGCGGCAACAACAGGAGCCATATGATATTCGCTTGATCACACCCCATGATCTTGAATGGATTGCTCAGGAA
TRN  10010101100011010
NAM  YPSA_BACSU/1-177
ASQ  M-KVLAITGYKPFELGIFKQDDKALYYIKKAIKNRLIAFLDEGLEWILISGQLGVELWAAEAAYDLQEEYPDLKVAVITPFYEQEKNWKEPNKEQYEAVLAQADYEASLTHRPYESPLQFKQKNQFFIDKSDGLLLLYDPEKEGSPKYMLGTAEKRREQDGYPIYFITMDDLRVTVEE
DSQ  ATG---AAAGTATTGGCAATAACGGGCTATAAACCGTTTGAACTGGGGATATTTAAGCAGGATGACAAGGCGCTGTATTACATAAAAAAAGCCATTAAAAACCGGCTGATTGCTTTTTTGGATGAAGGATTAGAATGGATTTTAATTTCGGGCCAGCTTGGAGTTGAGCTGTGGGCGGCAGAAGCTGCATATGATTTGCAGGAGGAATACCCTGACTTAAAGGTAGCTGTCATCACACCATTTTACGAGCAGGAAAAGAACTGGAAAGAACCGAATAAAGAACAGTATGAAGCAGTTCTGGCTCAGGCAGACTATGAAGCAAGCCTGACTCACCGTCCTTATGAAAGCCCGCTTCAATTCAAACAAAAAAATCAGTTCTTCATTGATAAGTCCGACGGGCTTCTGCTTTTATATGACCCGGAAAAGGAAGGCTCCCCTAAGTATATGCTTGGGACAGCGGAAAAAAGGCGCGAACAGGATGGCTATCCCATCTACTTTATTACAATGGATGACTTGAGAGTGACAGTGGAGGAA
TRN  10010101100011010
NAM  Q8Y613_LISMO/1-176
ASQ  M-KSIAVTGYKNFELGIFKKDADEAVYIKETIKRHLLPLVEDGLEWVIISGQLGIELWAGDVVAELKADYP-IKLAILEPFEKQSANWNEANQLWASEVLEKADYHAFITKRPYESPAQFAARDGFIIDNTDGALLVYDLEKEGSPKFFYDRATQAKEQSNYYIDCIDFYALQEVVED
DSQ  GTG---AAATCCATCGCAGTGACGGGGTATAAAAATTTTGAACTTGGAATTTTTAAAAAGGATGCAGATGAAGCGGTTTATATAAAAGAAACAATTAAACGGCATTTGCTTCCACTCGTGGAAGATGGGCTTGAATGGGTGATTATTTCTGGTCAGCTAGGGATTGAACTTTGGGCTGGCGATGTGGTTGCAGAATTAAAAGCAGACTATCCG---ATTAAACTAGCAATCCTTGAACCATTTGAAAAGCAAAGTGCTAACTGGAATGAAGCGAACCAATTATGGGCGAGCGAAGTACTAGAAAAAGCCGACTACCATGCTTTTATTACGAAGCGTCCTTATGAAAGTCCAGCGCAATTTGCAGCAAGAGATGGCTTTATTATTGATAATACAGACGGCGCGTTACTTGTATATGATTTAGAAAAAGAAGGTTCGCCGAAATTTTTTTATGACCGAGCGACTCAAGCAAAAGAACAGTCTAATTATTATATAGACTGCATTGATTTTTATGCACTCCAAGAAGTTGTAGAGGAC
TRN  10010101110011010
NAM  Q8CUT2_OCEIH/1-174
ASQ  M-KILMVTGYKPMELNIFKEDDSRIQFIKASIEKRVREFLEEGLEWVIISGQMGVELWAADVVMELKEEYP-VQLGVFPPFENQDGRWPDALKEKYEELTMTADFFKPIYKGDYQGPYQFRTKDMWLIDKSDACLLLMDEEFPGSTKYFYDTLQ--KTAKDYPVFTITPQDIDDVVED
DSQ  ATG---AAAATTTTAATGGTAACAGGTTACAAACCAATGGAATTAAATATCTTTAAAGAAGATGACTCTAGGATTCAATTTATAAAAGCTTCTATAGAAAAGCGGGTACGTGAATTTTTAGAAGAAGGGTTAGAATGGGTCATTATTTCTGGACAAATGGGAGTGGAGTTATGGGCTGCGGATGTTGTCATGGAATTAAAAGAAGAGTACCCT---GTTCAACTGGGTGTGTTTCCTCCTTTTGAGAATCAAGATGGTCGCTGGCCAGATGCGCTAAAAGAAAAATATGAGGAACTGACGATGACAGCTGATTTCTTTAAACCGATTTATAAAGGTGATTATCAAGGTCCTTATCAATTTCGAACAAAAGACATGTGGTTAATTGATAAAAGTGACGCTTGTTTGTTACTAATGGATGAAGAGTTTCCTGGAAGTACCAAATATTTTTATGATACGTTACAA------AAAACAGCTAAAGATTACCCTGTATTTACCATAACTCCCCAAGATATAGATGATGTTGTGGAAGAT
TRN  10010101100011010
NAM  Q99U41_STAAM/1-178
ASQ  MVKTVYVTGYKSFELNIFKDDAPEVHYLKQFIKHKIEQLLDEGLEWVLIQGQMGIELWTAEVVIELQRTYDSLKFAVITPFQGHTEKWNEHNQSKYANIIKHADYVDSIFHTSYQGPFQFKQADQFMLEHSDQTLLIYDEEQEASPKFFKQMLVDFMDKTNYTCDIVTFDELTAFIND
DSQ  ATGGTTAAAACAGTTTATGTAACAGGTTACAAATCATTCGAATTAAACATTTTTAAAGATGACGCACCTGAAGTACATTATTTAAAACAATTTATAAAACATAAAATTGAACAACTGTTGGATGAAGGATTAGAATGGGTGTTAATACAAGGGCAAATGGGTATAGAATTATGGACTGCAGAAGTTGTTATTGAATTACAACGAACATATGATTCGTTAAAGTTTGCTGTAATTACACCGTTCCAAGGACATACAGAAAAGTGGAATGAACATAATCAAAGTAAGTATGCCAACATAATTAAGCATGCAGATTATGTTGATAGTATTTTTCATACGTCGTATCAAGGTCCTTTTCAATTTAAACAAGCAGATCAATTTATGCTTGAACATTCGGATCAAACATTGCTCATTTATGATGAGGAACAAGAGGCAAGTCCTAAGTTCTTCAAGCAGATGTTAGTTGATTTTATGGATAAAACAAACTATACTTGTGATATTGTGACGTTCGATGAATTAACAGCATTCATCAATGAC
TRN  10010101100011000
NAM  Q8CSJ2_STAEP/1-178
ASQ  MVKTVYITGYKSFELNIYKDDAPEVYYLKQFIAHKLKHLLDEGLEWVLIQGQMGIELWSAEVVIELKKDFPDIKLGIITPFIGHTQRWNDKNQAKYTNIIQQADFTESIHHTEYMGAYQFKQADQFMLDHTDYTILIYDDEQEASPKYFKAMLVEFMEKTNYTCDIVTFDELTDFIND
DSQ  ATGGTTAAAACTGTTTATATTACTGGTTATAAATCTTTTGAACTGAATATCTATAAAGACGATGCGCCAGAAGTATATTATTTAAAGCAATTTATAGCTCATAAATTAAAACATCTTTTAGATGAAGGTTTAGAGTGGGTATTGATACAAGGACAAATGGGTATAGAATTATGGTCTGCTGAAGTAGTGATTGAACTAAAAAAAGACTTCCCAGATATTAAACTAGGTATAATTACGCCATTTATAGGTCATACACAACGATGGAATGATAAGAATCAAGCTAAGTATACAAATATTATACAACAAGCCGATTTTACTGAAAGCATTCATCACACTGAGTATATGGGTGCCTATCAATTTAAACAAGCAGATCAATTCATGCTTGATCATACCGATTACACTATTTTAATTTATGATGATGAACAAGAGGCAAGCCCTAAATACTTTAAGGCTATGTTAGTTGAATTTATGGAAAAAACAAACTATACTTGTGATATTGTGACGTTTGATGAACTCACTGACTTCATCAACGAC
TRN  10010101100011010
NAM  Q9CI21_LACLA/1-171
ASQ  M-NSLLIMGYTSFDLGIFNEKDIKVSIIKKTIRRKLINFLEEGLRWIIFTGNLGFEYWALEVAKELQTDYD-FQIGTIFSFETHGQNWNESNQVKLAA-FKQVDFVKYAFET-YESPSQFRQYNDFILENTEGAFVFYDEENETKLKYMVEKMK---QNTNYEVYLLDFEDLQETFEE
DSQ  ATG---AATTCACTACTAATCATGGGTTATACAAGTTTTGACCTAGGTATTTTCAATGAAAAAGACATAAAAGTATCAATAATAAAAAAAACAATTAGAAGAAAATTAATTAACTTTTTGGAGGAAGGCCTTCGTTGGATTATTTTTACAGGTAATTTGGGTTTTGAATACTGGGCGTTGGAAGTAGCAAAGGAACTTCAGACAGATTATGAC---TTTCAAATTGGGACAATTTTTTCTTTTGAAACACATGGCCAAAATTGGAACGAAAGTAATCAAGTTAAGTTGGCAGCT---TTCAAACAAGTAGATTTTGTGAAATATGCTTTTGAAACT---TATGAAAGTCCAAGCCAATTCCGCCAGTACAATGATTTTATACTGGAAAATACCGAGGGAGCTTTTGTTTTTTACGATGAAGAAAATGAGACAAAATTAAAATATATGGTTGAAAAAATGAAA---------CAAAACACTAATTATGAAGTTTATTTGCTTGATTTTGAAGATTTACAAGAAACTTTTGAAGAA
TRN  10010101100011000
NAM  Q8K6D7_STRP3/1-171
ASQ  M-TAILITGYRSFEIGIFDHKDPRVSIIKQAIRKDLIGYLENGVDWFIFTGNLGFEQWALEVANELKEEYP-LQIATIFLFETHGDKWNEKNQEVLSQ-FRAVDFVKYYFPN-YEQPTQFSQYYQFLLEKTEGAYVFYDTENETNLKYFLKKAK---DMPYYQLLLLTFDRLNDMSQS
DSQ  ATG---ACTGCGATTCTAATTACAGGTTACCGAAGCTTTGAAATAGGGATTTTTGACCATAAAGACCCACGAGTTTCAATTATTAAACAGGCTATTCGTAAAGATTTAATAGGTTATTTGGAAAATGGTGTGGATTGGTTTATCTTTACAGGGAACTTGGGTTTTGAACAATGGGCTTTGGAAGTAGCTAATGAGCTAAAAGAGGAGTATCCC---TTGCAGATAGCTACTATATTCTTGTTTGAAACGCATGGAGATAAGTGGAATGAAAAAAATCAAGAAGTTTTAAGTCAG---TTTAGGGCTGTTGACTTTGTAAAATATTACTTTCCAAAT---TACGAACAACCAACGCAATTTAGTCAATATTATCAGTTTTTATTAGAAAAGACAGAAGGGGCTTATGTTTTTTATGACACAGAAAACGAAACCAACTTAAAATATTTTCTCAAGAAAGCAAAA---------GATATGCCGTATTATCAGTTGCTATTGCTAACCTTTGATCGGCTAAATGATATGTCACAAAGC
TRN  10010101110011000
NAM  Q8E1Q3_STRA5/1-172
ASQ  MKSTILVTGYKNFELGIFQDKDPRITIIKKAIDKDFRRFLENGADWFIFMGNLGFEYWALEVALDLQKEYD-FQIATIFTFENHGQNWNEANKAKLAL-FKQVDFVKYTFPS-YENPGQFKQYNHFLINNTQGAYLFYDSENETNLKFLLEMME---KKEAYDISFLTFDRLNEIYEE
DSQ  ATGAAGTCAACTATTCTTGTAACAGGTTACAAAAATTTTGAATTAGGGATTTTCCAGGATAAGGATCCTCGGATTACTATTATAAAAAAGGCTATTGATAAGGATTTTAGACGCTTCTTGGAAAATGGAGCAGACTGGTTTATTTTTATGGGAAATTTAGGGTTTGAGTACTGGGCTTTGGAAGTTGCTCTTGATTTACAAAAAGAATATGAT---TTTCAAATTGCGACAATTTTTACCTTTGAGAACCATGGCCAAAATTGGAATGAGGCTAATAAAGCTAAGTTGGCACTC---TTTAAGCAAGTTGACTTTGTTAAATATACTTTCCCAAGC---TATGAAAACCCGGGTCAATTTAAACAATACAATCATTTTCTCATTAACAACACACAAGGTGCATATCTTTTTTATGATTCTGAAAATGAAACTAATTTAAAATTTTTGCTAGAAATGATGGAG---------AAAAAGGAAGCTTATGATATTTCTTTCCTAACTTTTGATCGCTTAAATGAAATATATGAGGAA
TRN  10010101110011000
NAM  Q8DVL2_STRMU/1-171
ASQ  M-TTILVTGYKNFELGIFQDKDPKITIIKKAIKRDFIHFLEEGVDWFVFMGNLGFEYWALEVALSLQTEYD-MQLATIFPFENHGEHWSEANQEKLFK-FKQTDFVKSSYKR-YQNSYQFKKYNQFLLDNTDRAYLFYDKDKETNLKYLYQMMT---AKDNYPVSLLTFEDLDDIVQD
DSQ  ATG---ACGACAATTCTTGTAACGGGTTATAAAAATTTTGAATTGGGAATTTTTCAGGATAAGGATCCTAAAATAACAATTATCAAGAAAGCAATTAAGCGAGACTTCATTCATTTTCTTGAAGAAGGAGTGGATTGGTTTGTTTTTATGGGTAATTTGGGCTTTGAGTACTGGGCTTTAGAGGTTGCTTTAAGTCTCCAAACAGAATATGAT---ATGCAACTGGCTACTATCTTTCCCTTTGAAAATCATGGAGAGCACTGGAGTGAAGCTAATCAGGAAAAGCTCTTTAAA---TTTAAACAGACAGACTTTGTAAAAAGTAGCTATAAACGT---TATCAAAATTCCTATCAATTTAAAAAATATAATCAATTTTTGTTGGATAATACGGATAGAGCTTATCTATTTTATGATAAAGATAAGGAAACGAATTTAAAATATCTTTATCAAATGATGACA---------GCTAAGGATAACTACCCTGTGAGCCTGCTTACTTTTGAAGATTTAGATGACATCGTTCAGGAC
TRN  10010101100011010
NAM  Q8DR58_STRR6/1-171
ASQ  M-ATALVLGYSAFDLGLFSDKDPRLKLIKKAIRKDLEAMAADGVSWLVFTGSLGFEYWVLEVAQEMKTEYG-FQLATIFAFETHGENWNEGNQMKLSR-FKQVDFVKYAYPR-YEHKGQLRDYQQFLLENTTSSYLFYDEENETKLAYFYQKMK---NQEDYFIKRLTFDQLNELAEN
DSQ  ATG---GCTACAGCTTTGGTTTTAGGCTATTCTGCTTTTGATTTGGGTTTATTTTCTGATAAGGATCCTCGTCTTAAATTGATTAAAAAAGCGATACGTAAAGATTTAGAGGCTATGGCAGCAGATGGGGTGTCTTGGCTTGTGTTTACAGGAAGTTTGGGTTTTGAATATTGGGTTTTAGAGGTTGCTCAGGAGATGAAAACCGAATACGGT---TTCCAGTTGGCCACCATTTTTGCTTTTGAAACCCATGGGGAAAATTGGAATGAAGGCAATCAGATGAAACTGAGTCGC---TTTAAGCAGGTAGACTTTGTCAAATATGCTTATCCTCGC---TATGAACACAAGGGGCAGTTAAGAGATTACCAGCAGTTTTTGCTGGAAAACACGACTAGTTCCTATCTTTTTTATGATGAAGAAAATGAAACAAAACTAGCTTATTTTTACCAAAAGATGAAA---------AATCAAGAGGACTATTTTATAAAGAGATTAACATTTGATCAATTAAATGAACTTGCTGAAAAT
TRN  10010101100011010
NAM  Q88W96_LACPL/1-177
ASQ  M-SRLWLSGYRSYELNVFGDQDDKLKVIKFALTNYLTTQIEDGMDWLITGGQLGIEQWTAEVGLTLKKTYPELKVAMMLPYGEFGGRWNENNQAKLQTLLAQVDFHAPVSKQPYENPQQLKNYQEFMVTHTDAATLVYDPDNPGKPTYDYDLIRNFSDTHPYPLTLIDFDWLQESANE
DSQ  ATG---AGCCGGTTGTGGCTTAGTGGTTACCGGAGTTACGAGTTGAATGTCTTTGGTGATCAGGATGATAAACTAAAAGTTATTAAGTTTGCGTTAACTAATTACTTAACGACGCAGATCGAGGATGGTATGGATTGGCTGATAACGGGTGGTCAGCTCGGTATTGAACAGTGGACAGCGGAAGTAGGGTTAACGCTCAAAAAGACATATCCAGAATTGAAAGTGGCAATGATGTTACCATATGGTGAATTTGGTGGGCGCTGGAATGAAAATAACCAAGCTAAATTACAGACTTTGCTGGCCCAAGTCGATTTTCATGCACCAGTCAGTAAACAACCGTATGAAAATCCGCAACAATTAAAAAATTACCAAGAATTTATGGTTACCCATACGGATGCGGCCACTCTGGTATATGATCCAGATAACCCCGGGAAACCCACGTATGACTATGATTTGATTCGGAACTTTAGTGACACTCATCCGTACCCATTGACCCTGATCGACTTCGACTGGTTACAGGAAAGTGCCAATGAA
TRN  10010101100011010
//