EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06871 - TraH_2)
FAM  PF06871
PID  TraH_2
DES  TraH_2
IPR  IPR010680
ANO  4
ALN  209
AID  0.62188
APH  ((Y4DP_RHISN/1-199:0.20227,Q9F5D7_AGRRH/1-201:0.06295):0.43305,O68015_9RHIZ/1-206:0.27020,Q44367_9RHIZ/1-206:0.14355);
ATP  ((Y4DP_RHISN/1-199,Q9F5D7_AGRRH/1-201),O68015_9RHIZ/1-206,Q44367_9RHIZ/1-206);
ATL  1.11203
DNO  4
DLN  627
DID  0.634053
DPH  ((Q44367_9RHIZ/1-206:21.71496,O68015_9RHIZ/1-206:15.02029):31.04753,Q9F5D7_AGRRH/1-201:10.00225,Y4DP_RHISN/1-199:24.78711);
DTP  ((Q44367_9RHIZ/1-206,O68015_9RHIZ/1-206),Q9F5D7_AGRRH/1-201,Y4DP_RHISN/1-199);
DTL  102.594
RID  0.62188
RPH  ((Y4DP_RHISN/1-199:0.20227,Q9F5D7_AGRRH/1-201:0.06295):0.43305,O68015_9RHIZ/1-206:0.27020,Q44367_9RHIZ/1-206:0.14355);
RTP  ((Y4DP_RHISN/1-199,Q9F5D7_AGRRH/1-201),O68015_9RHIZ/1-206,Q44367_9RHIZ/1-206);
RTL  1.11203
LNK  O68015_9RHIZ/1-206:O68015:AF010180
LNK  Q44367_9RHIZ/1-206:Q44367:AF242881
LNK  Q9F5D7_AGRRH/1-201:Q9F5D7:AP002086
LNK  Y4DP_RHISN/1-199:P55415:AE000069
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q44367_9RHIZ/1-206
ASQ  MVDAALIKQCADPALKPAIVEQFIARAGSQDSLAITVRSGNRVVLVPKPTTSDEAMDLIRQNIGRNTIRVGITQYPAGLGILDAGQLKPDLVDACENIRMGTALFAKVWRIVMKWYGNPTAAAVLPQVMDDAIIAWQTGYFEGTAVFRAEDPGEGEVSQP---ATIQSDEAETKTGSRENAGDENPPSKAISSDPNKAGIRIDLSGIGA
DSQ  ATGGTCGATGCCGCCCTTATAAAACAATGCGCCGATCCGGCCCTGAAGCCCGCAATTGTCGAGCAGTTCATCGCGCGCGCCGGATCGCAGGATTCTCTAGCGATCACCGTGCGCTCCGGTAACCGGGTCGTGCTCGTGCCGAAACCGACAACGTCGGACGAAGCCATGGACCTGATCCGCCAGAACATCGGCCGCAACACCATTCGCGTTGGCATCACTCAATATCCCGCCGGTCTCGGTATCCTCGACGCCGGTCAGTTGAAGCCGGATCTGGTCGATGCCTGCGAGAACATTCGCATGGGTACGGCGCTCTTCGCCAAGGTCTGGCGAATCGTCATGAAATGGTATGGCAATCCGACTGCTGCTGCCGTGCTGCCGCAAGTAATGGATGATGCGATCATCGCCTGGCAGACGGGATACTTCGAGGGGACGGCGGTGTTTCGGGCAGAAGATCCTGGCGAGGGCGAAGTTTCCCAACCA---------GCTACGATCCAGAGTGATGAAGCCGAAACAAAAACCGGCTCTCGAGAAAATGCAGGAGACGAAAATCCGCCATCCAAAGCTATCTCGTCCGATCCAAACAAGGCTGGCATCAGGATCGACCTGTCCGGGATAGGAGCT
TRN  10010101100011011
NAM  O68015_9RHIZ/1-206
ASQ  MVDSALIKECSDPGLKPAIVEQFIERAGAPDPLAVTVRSGNRIVLVPRPTTPDEALALIRQNLGRNIVRVGLTQYPAGLGIVEAGQLKPDLIEPCENIKMGTALFAKVYRIVTKWYGNPTESEVLPQVFEDAIIAWQTGYFEGTAVFRAADPGDVKLPEPD---PGVEAETSEAGSDKMKGGNVDTALEAEPADPNKAGIRIDLSGIGA
DSQ  ATGGTCGATTCCGCCCTCATCAAGGAATGCAGCGATCCCGGCCTGAAACCCGCGATCGTCGAACAGTTCATCGAACGGGCAGGGGCGCCGGACCCGCTCGCGGTCACTGTCCGCTCCGGCAACCGCATCGTGCTTGTGCCGAGGCCGACAACGCCGGACGAGGCGCTCGCATTGATACGCCAGAACCTCGGTCGCAATATCGTTCGGGTCGGCTTGACGCAGTATCCCGCCGGGCTCGGTATCGTCGAGGCGGGCCAGTTGAAGCCGGACCTGATCGAGCCTTGCGAAAACATCAAAATGGGCACGGCCCTGTTCGCCAAAGTCTATCGTATCGTCACCAAATGGTACGGTAACCCTACCGAAAGCGAGGTCCTTCCGCAGGTTTTTGAAGACGCGATCATCGCATGGCAAACGGGGTATTTCGAGGGGACAGCGGTGTTCCGGGCAGCCGATCCGGGCGACGTGAAGCTGCCAGAGCCGGAT---------CCTGGGGTGGAAGCGGAAACGTCCGAAGCCGGTAGTGACAAGATGAAGGGCGGCAACGTCGATACTGCACTCGAGGCGGAACCAGCTGACCCGAACAAGGCCGGTATTCGGATCGACCTTTCCGGCATCGGCGCG
TRN  10010101100011011
NAM  Y4DP_RHISN/1-199
ASQ  MLDAALIKECADPSLKPAIVEQFVAAAGSTDPLAVSVESGGRLILVPKATSAGEAMAIVRQYVGQAVVRVGLTQFPVGVGVKNAADLQPDLVDACENLRKGTSMFAKVLRIVAKSYGNPESDDVIPQIFEDAVYAWKTGEFEGVSVFQAPDPGG-SVATEEVLRSDDRDSHTQDS------ASEWPEG---NDSVGSAAMRIDLSRIGG
DSQ  ATGCTCGACGCTGCCCTAATCAAAGAATGCGCCGATCCTTCTCTCAAGCCCGCGATCGTCGAGCAGTTCGTCGCAGCCGCCGGCTCGACGGACCCGCTCGCCGTTTCAGTTGAATCGGGTGGACGATTGATCCTCGTGCCGAAAGCGACTTCCGCCGGCGAGGCGATGGCAATCGTGAGGCAATATGTGGGTCAGGCGGTGGTTCGCGTCGGCCTGACACAGTTTCCAGTGGGCGTCGGCGTGAAGAACGCAGCAGACCTTCAGCCGGACCTCGTCGACGCCTGCGAAAACCTTCGCAAGGGAACCTCGATGTTTGCCAAGGTTCTTAGGATCGTTGCCAAGTCGTATGGCAATCCCGAGAGCGACGACGTCATCCCTCAAATATTCGAGGATGCTGTCTACGCATGGAAGACGGGTGAGTTCGAAGGCGTGAGCGTGTTTCAGGCTCCTGATCCGGGTGGC---AGCGTTGCGACGGAAGAAGTGTTGCGGTCGGATGACCGCGATAGTCATACTCAAGACTCG------------------GCCTCTGAATGGCCTGAGGGA---------AACGACAGCGTTGGATCGGCAGCAATGCGGATCGATCTTTCCCGCATCGGGGGA
TRN  10010101100011001
NAM  Q9F5D7_AGRRH/1-201
ASQ  MLDAALIKECADPSLKPAIVEQFVASAGSADPLAVTVKSGGRLILVPKAASADEAIAIVRQYAGQAVVRVGLTQFPAGVGVKEAADLKPDLVDACQNLRKGTAMFAKVLRIVAKWYGNPTSKDVFPQIFEDAIYAWKTGEFEGVSVFQAEDPGT-PV---EVPRSEERIPAEEES-AEPRPGEDAPET---VQEVGRAGIRIDLSRIGG
DSQ  ATGCTGGACGCAGCCCTGATCAAAGAATGCGCCGACCCTTCCCTAAAACCCGCGATCGTCGAGCAGTTCGTGGCATCAGCAGGGTCGGCTGATCCCCTCGCCGTCACCGTCAAATCCGGTGGCCGTTTGATCCTCGTGCCGAAAGCAGCGTCGGCTGACGAGGCGATCGCGATCGTGCGGCAATATGCTGGTCAGGCGGTCGTCCGTGTTGGGCTGACCCAGTTTCCCGCCGGCGTCGGCGTCAAAGAGGCGGCGGATCTGAAGCCCGATCTTGTCGATGCCTGCCAGAACCTCCGCAAAGGCACGGCGATGTTCGCCAAGGTCCTGAGGATTGTTGCGAAATGGTACGGGAACCCCACGAGCAAAGACGTTTTCCCGCAGATCTTCGAGGATGCCATCTACGCATGGAAGACCGGCGAATTCGAGGGCGTGAGTGTGTTTCAGGCGGAGGATCCAGGAACA---CCGGTT---------GAAGTGCCGCGAAGCGAGGAGAGGATTCCCGCCGAGGAAGAGAGC---GCCGAACCGAGACCGGGAGAAGATGCGCCCGAGACA---------GTGCAGGAGGTCGGGCGCGCGGGGATACGCATCGATCTGTCCCGCATTGGAGGT
TRN  10010101100011001
//