EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06859 - Bin3)
FAM  PF06859
PID  Bin3
DES  Bicoid-interacting protein 3 (Bin3)
IPR  IPR010675
ANO  5
ALN  112
AID  0.420368
APH  (Q9VNH1_DROME/190-299:0.40244,(Q8K3A9_MOUSE/550-659:0.29112,Q9LU61_ARATH/270-379:0.61780):0.15483,(Q9U2R0_CAEEL/256-364:0.23720,Q9Y7L2_SCHPO/146-256:1.07945):0.24353);
ATP  (Q9VNH1_DROME/190-299,(Q8K3A9_MOUSE/550-659,Q9LU61_ARATH/270-379),(Q9U2R0_CAEEL/256-364,Q9Y7L2_SCHPO/146-256));
ATL  3.02635
DNO  5
DLN  336
DID  0.47591
DPH  ((Q9LU61_ARATH/270-379:0.48416,(Q9VNH1_DROME/190-299:0.29508,Q8K3A9_MOUSE/550-659:0.33866):0.18033):0.21557,Q9U2R0_CAEEL/256-364:0.18560,Q9Y7L2_SCHPO/146-256:0.70626);
DTP  ((Q9LU61_ARATH/270-379,(Q9VNH1_DROME/190-299,Q8K3A9_MOUSE/550-659)),Q9U2R0_CAEEL/256-364,Q9Y7L2_SCHPO/146-256);
DTL  2.40566
RID  0.420368
RPH  (Q9VNH1_DROME/190-299:0.40244,(Q8K3A9_MOUSE/550-659:0.29112,Q9LU61_ARATH/270-379:0.61780):0.15483,(Q9U2R0_CAEEL/256-364:0.23720,Q9Y7L2_SCHPO/146-256:1.07945):0.24353);
RTP  (Q9VNH1_DROME/190-299,(Q8K3A9_MOUSE/550-659,Q9LU61_ARATH/270-379),(Q9U2R0_CAEEL/256-364,Q9Y7L2_SCHPO/146-256));
RTL  3.02635
LNK  Q8K3A9_MOUSE/550-659:Q8K3A9:BC026876
LNK  Q9LU61_ARATH/270-379:Q9LU61:AB023044
LNK  Q9U2R0_CAEEL/256-364:Q9U2R0:AL023828
LNK  Q9VNH1_DROME/190-299:Q9VNH1:AE003602
LNK  Q9Y7L2_SCHPO/146-256:Q9Y7L2:AL049495
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9Y7L2_SCHPO/146-256
ASQ  KFKIILALSVSKWVHLNNHDEGIIKFFGKISSLLETNGVLILEPQGWDSYLKAAKKISVFNQTPENLKIQPDAFEHLLNQAGL-VLEYSIEPQVNNSEYKNFAKRTMYIYKK
DSQ  AAATTCAAAATAATACTAGCATTATCCGTATCTAAATGGGTGCATCTAAATAACCACGATGAAGGAATCATTAAATTCTTTGGGAAGATTAGTTCTTTATTGGAAACGAATGGTGTTCTTATTTTAGAACCTCAAGGATGGGACTCGTACTTGAAAGCTGCAAAAAAAATATCTGTTTTTAATCAAACACCTGAGAACCTCAAAATCCAACCTGATGCGTTTGAACATTTGCTTAATCAAGCAGGACTA---GTGCTTGAATACAGTATCGAACCTCAAGTAAATAACTCTGAGTACAAGAATTTTGCCAAACGAACAATGTATATCTATAAAAAA
TRN  10010101110011010
NAM  Q9LU61_ARATH/270-379
ASQ  RYDTILCLSVTKWVHLNWGDDGLITLFSKIWRLLQPGGIFVMEPQPWKSYENNRRVSETTAMNYRTIVLRPDRFQEILLD-KIGFRTVEDLTSSLSGASKGF-DRQILAFQK
DSQ  CGTTATGATACAATTCTATGTTTGAGTGTGACAAAATGGGTTCATTTGAACTGGGGTGATGATGGTTTAATCACCTTATTTTCAAAGATTTGGCGTCTTCTTCAACCGGGTGGTATCTTTGTAATGGAACCTCAGCCTTGGAAATCTTATGAAAACAATCGTCGTGTCTCAGAGACAACTGCAATGAATTACCGAACGATTGTTTTACGACCAGACCGTTTCCAAGAAATTCTTCTTGAT---AAGATTGGGTTTAGAACAGTGGAAGATCTTACATCAAGCTTGTCCGGTGCAAGCAAAGGGTTT---GATAGACAGATTCTTGCGTTCCAGAAA
TRN  10010101110011000
NAM  Q9VNH1_DROME/190-299
ASQ  QFDVILCLSVTKWIHLNFCDSGLKQAFRRMYLQLRPGGKLILEPQSFDGYKRRKKLSEQIRDNYNAIKFRPDHFTEYLLSPEVGFAEMK-LMGIPEHCKVGF-KRPIQIFTK
DSQ  CAGTTCGACGTCATACTCTGCCTGTCTGTCACTAAGTGGATCCACCTTAATTTCTGTGATTCCGGCCTGAAGCAGGCCTTCAGACGCATGTACCTGCAGCTGCGCCCGGGCGGCAAGCTGATCCTGGAACCTCAGTCCTTCGACGGCTACAAGAGGCGCAAGAAGCTATCGGAACAAATAAGAGATAACTACAATGCAATTAAATTCCGACCTGATCATTTCACCGAATATCTGCTTAGCCCGGAAGTGGGCTTTGCCGAAATGAAA---CTTATGGGCATACCGGAGCACTGCAAAGTAGGATTC---AAGCGACCGATCCAAATTTTTACAAAG
TRN  10010101100011011
NAM  Q8K3A9_MOUSE/550-659
ASQ  EYDVVLCFSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYCKRKSLTETIYKNYFRIQLKPEQFSSYLTSPEVGFSSYE-LVATPNNTSRGF-QRPVYLFHK
DSQ  GAGTATGATGTGGTGCTGTGCTTCAGCCTCACCAAGTGGGTGCACCTGAACTGGGGTGATGAGGGGCTGAAGAGAATGTTCCGCCGCATCTACCGGCACCTGCGCCCTGGGGGTATTCTGGTCCTGGAGCCCCAACCATGGTCCTCCTACTGCAAGAGAAAGTCTCTCACGGAAACAATCTATAAGAACTACTTTCGAATCCAGTTGAAGCCAGAACAGTTCAGTTCCTACCTGACATCCCCAGAGGTGGGTTTCTCCAGCTATGAG---CTTGTGGCCACACCGAATAACACCTCCAGAGGCTTC---CAGCGTCCTGTGTACTTGTTCCACAAG
TRN  10010101100011011
NAM  Q9U2R0_CAEEL/256-364
ASQ  EFDVILALSITKWIHLNWGDDGMRRFFRRAYAQLHPGGRLIIEPQAFDSYKKRAKMSEELKANYSKIEFKPEDFEMWLIET-VGFESVE-KLGVVGAKSKGF-ERPIDVYLK
DSQ  GAATTTGATGTGATTCTTGCATTATCAATTACAAAATGGATTCATTTGAATTGGGGTGATGATGGAATGAGGAGATTCTTTAGAAGAGCTTATGCTCAACTTCATCCTGGAGGCCGCCTAATCATCGAACCACAAGCATTCGACAGCTACAAAAAACGTGCAAAAATGAGCGAGGAGTTGAAGGCAAATTACTCGAAAATCGAGTTTAAGCCCGAGGATTTCGAGATGTGGCTCATCGAAACT---GTCGGATTTGAATCTGTGGAA---AAGCTGGGCGTCGTCGGAGCCAAATCAAAAGGATTC---GAACGTCCGATTGATGTTTATTTGAAG
TRN  10010101100011000
//