EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06833 - MdcE)
FAM  PF06833
PID  MdcE
DES  Malonate decarboxylase gamma subunit (MdcE)
IPR  IPR009648
ANO  9
ALN  258
AID  0.364828
APH  (Q9Z449_PSEPU/6-260:0.19613,Q9I6S6_PSEAE/11-268:0.17127,((((Q89UY5_BRAJA/5-233:0.23986,Q89XP1_BRAJA/5-233:0.33725):0.42297,(O54417_ACICA/5-236:0.59652,(Q8P4U4_XANCP/5-230:0.36828,Q93L25_BURCE/5-230:0.47644):0.02979):0.11163):1.27133,O32714_KLEPN/10-266:0.15727):0.23437,Q87V58_PSESM/9-266:0.17386):0.09164);
ATP  (Q9Z449_PSEPU/6-260,Q9I6S6_PSEAE/11-268,((((Q89UY5_BRAJA/5-233,Q89XP1_BRAJA/5-233),(O54417_ACICA/5-236,(Q8P4U4_XANCP/5-230,Q93L25_BURCE/5-230))),O32714_KLEPN/10-266),Q87V58_PSESM/9-266));
ATL  4.87133
DNO  9
DLN  774
DID  0.480624
DPH  (((((Q8P4U4_XANCP/5-230:14.80417,((Q89UY5_BRAJA/5-233:14.57251,Q89XP1_BRAJA/5-233:10.86333):14.30793,Q93L25_BURCE/5-230:17.04334):2.30534):2.94212,O54417_ACICA/5-236:26.74373):25.56617,O32714_KLEPN/10-266:3.01071):11.41215,Q87V58_PSESM/9-266:7.14155):4.79360,Q9I6S6_PSEAE/11-268:7.38368,Q9Z449_PSEPU/6-260:8.66940);
DTP  (((((Q8P4U4_XANCP/5-230,((Q89UY5_BRAJA/5-233,Q89XP1_BRAJA/5-233),Q93L25_BURCE/5-230)),O54417_ACICA/5-236),O32714_KLEPN/10-266),Q87V58_PSESM/9-266),Q9I6S6_PSEAE/11-268,Q9Z449_PSEPU/6-260);
DTL  3.57646
RID  0.364828
RPH  (Q9Z449_PSEPU/6-260:0.19613,Q9I6S6_PSEAE/11-268:0.17127,((((Q89UY5_BRAJA/5-233:0.23986,Q89XP1_BRAJA/5-233:0.33725):0.42297,(O54417_ACICA/5-236:0.59652,(Q8P4U4_XANCP/5-230:0.36828,Q93L25_BURCE/5-230:0.47644):0.02979):0.11163):1.27133,O32714_KLEPN/10-266:0.15727):0.23437,Q87V58_PSESM/9-266:0.17386):0.09164);
RTP  (Q9Z449_PSEPU/6-260,Q9I6S6_PSEAE/11-268,((((Q89UY5_BRAJA/5-233,Q89XP1_BRAJA/5-233),(O54417_ACICA/5-236,(Q8P4U4_XANCP/5-230,Q93L25_BURCE/5-230))),O32714_KLEPN/10-266),Q87V58_PSESM/9-266));
RTL  4.87133
LNK  O32714_KLEPN/10-266:O32714:U95087
LNK  O54417_ACICA/5-236:O54417:AF121266
LNK  Q87V58_PSESM/9-266:Q87V58:AE016874
LNK  Q89UY5_BRAJA/5-233:Q89UY5:BA000040
LNK  Q89XP1_BRAJA/5-233:Q89XP1:BA000040
LNK  Q8P4U4_XANCP/5-230:Q8P4U4:AE012482
LNK  Q93L25_BURCE/5-230:Q93L25:AF029344
LNK  Q9I6S6_PSEAE/11-268:Q9I6S6:AE004459
LNK  Q9Z449_PSEPU/6-260:Q9Z449:AB017138
AMK  xxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9Z449_PSEPU/6-260
ASQ  NWLSGLAGGQA.LPGYPASLLVIDGELDNRLVRFIAVVPDAENPFPRARSGEVGLLEGWGLAKAVSEAVAADR-NGQKRAIVAVIDVPSQAYGRREEALGIHQALAGAVQAYAQARLAGHPVIGLLVGKAMSGAFLAHGYQAQRLIALDDAGVMVHAMGKAAAARITLRSVEQLEALAAEVPPMAYDLDNYASLGLLWRRLTVDNAEAPSSADIAQVRACLTEAVRDI-GSSTDLSSRLAGENRSASRQVREQLRRQW
DSQ  AACTGGCTGTCGGGCCTGGCCGGCGGGCAAGCC...TTGCCGGGCTATCCCGCATCGTTGCTGGTGATCGACGGCGAACTGGACAACCGCCTGGTGCGCTTCATCGCCGTGGTGCCTGATGCTGAAAACCCGTTCCCCCGCGCACGCTCGGGCGAGGTCGGTCTGCTGGAAGGCTGGGGCCTGGCCAAGGCCGTGAGCGAGGCGGTGGCGGCTGACCGC---AACGGACAGAAGCGGGCCATTGTCGCGGTGATCGATGTACCCAGCCAGGCCTATGGCCGCCGTGAGGAGGCCTTGGGTATCCACCAGGCCTTGGCCGGTGCCGTGCAGGCCTATGCCCAGGCGCGGCTGGCCGGGCACCCGGTGATCGGCTTGCTGGTTGGCAAGGCCATGTCCGGTGCCTTCCTGGCTCATGGCTATCAGGCCCAGCGTTTGATCGCTCTGGACGATGCCGGGGTGATGGTGCACGCCATGGGCAAGGCGGCGGCGGCGCGGATTACCCTGCGCAGCGTCGAGCAACTGGAGGCCCTGGCCGCCGAAGTGCCGCCCATGGCCTACGACCTGGATAATTATGCCTCGCTGGGCCTGCTGTGGCGCCGCTTGACCGTGGACAACGCCGAAGCCCCGAGCAGCGCCGACATTGCCCAAGTACGTGCCTGCCTGACCGAAGCCGTGCGCGACATT---GGCAGTTCGACCGACCTGTCGTCGCGGCTGGCGGGTGAAAACCGCAGTGCCTCGCGTCAGGTACGTGAACAGCTGCGCCGCCAGTGG
TRN  11011111101111111
NAM  Q9I6S6_PSEAE/11-268
ASQ  AWFQALAGSLApRPGDPASLRVADAELDGYPVRFLAVVPDPDNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAYGRREEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHDPGVMVHAMGKAAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEVPSTADLVRVRTCLGEALADILGGPRDLGGRLGAANREASARVRRLLREQW
DSQ  GCCTGGTTCCAGGCGCTGGCCGGTAGCCTCGCGccgCGTCCCGGCGATCCTGCTTCGTTGCGCGTCGCCGATGCCGAGCTGGACGGCTACCCGGTGCGTTTCCTGGCCGTCGTGCCCGATCCCGACAATCCGTTCCCGCGCGCTCGCCAGGGCGAGGTCGGGCTGCTCGAGGGCTGGGGCCTGGCCGCCGCCGTCGACGAGGCGCTGGAGGCCGACCGCGAGGCGCCACGCAAGCGCGCGCTGCTGGCCATCGTCGACGTGCCGAGCCAGGCCTACGGCCGCCGCGAGGAGGCCCTGGGTATCCACCAGGCGCTGGCCGGGGCGGTGGATGCCTACGCCCGCGCCCGACTCGCCGGGCATCCGCTGATCGGCCTGCTGGTGGGCAAGGCGATGTCCGGCGCGTTCCTCGCCCACGGCTACCAGGCCAACCGCCTGATCGCTTTGCACGATCCGGGGGTGATGGTCCACGCCATGGGCAAGGCCGCCGCCGCGCGGATCACCCTGCGCAGCGTCGAGGAACTGGAGGCGTTGGCGGCGAAGGTGCCGCCGATGGCCTACGACATCGACAGCTACGCGTCGCTCGGCCTGCTCTGGAGGACCCTTCCGGTGGAGACCGTCGAGGTGCCGTCGACGGCGGACCTGGTGCGGGTCCGCACCTGCCTGGGCGAGGCCCTGGCCGATATCCTCGGCGGCCCGCGCGACCTCGGCGGCCGCCTCGGCGCGGCCAACCGCGAGGCGTCGGCGCGGGTGCGCCGGCTGCTGCGCGAGCAGTGG
TRN  10010101100011011
NAM  Q87V58_PSESM/9-266
ASQ  NWFNALSADASeVTGLPASLKVADGLLGEQPVRFVAVIADTNNRFPRARQGEVGLLEGWGLAKAVDDAIEQDRERAEKRALIAIVDVPSQAYGRREEALGIHQALAGAVDSYARARLAGHPVIGLLVGKAMSGAFLAHGYQANRLIALRDPGVMVHAMGKASAARVTQRSVDDLEKLAASIAPMAYDIDSYASLGLLWETLSVSQIEQPAVDDLTQVRQVLSSAIKDVQASGVDLSSRLGASNRKASAHVRQLLRAQW
DSQ  AACTGGTTCAACGCGCTGAGCGCAGACGCGAGCgaaGTGACCGGTCTACCGGCTTCGCTCAAAGTGGCCGATGGCTTGCTGGGTGAGCAGCCGGTGCGCTTTGTGGCGGTGATTGCCGACACCAACAACCGCTTTCCTCGGGCGCGTCAGGGTGAAGTCGGCTTGTTGGAAGGCTGGGGTCTTGCCAAGGCGGTGGACGATGCCATCGAACAGGATCGCGAGCGCGCCGAAAAACGTGCGCTGATTGCGATTGTCGATGTGCCGAGCCAGGCGTATGGCCGTCGCGAGGAAGCGCTCGGCATCCATCAGGCGCTGGCCGGCGCGGTAGACAGTTACGCGCGGGCGCGGTTGGCCGGGCATCCGGTGATTGGCCTGTTGGTTGGCAAGGCGATGTCCGGCGCATTCCTGGCTCACGGCTATCAAGCCAATCGGTTGATTGCGTTGCGCGACCCTGGCGTGATGGTGCACGCGATGGGCAAGGCCTCGGCCGCCCGCGTTACCCAGCGCAGTGTCGATGACCTGGAAAAGCTCGCCGCCAGCATTGCGCCCATGGCTTACGATATCGACAGCTACGCCAGCCTCGGCCTGCTGTGGGAAACCCTGTCGGTCAGCCAGATCGAACAGCCCGCTGTGGACGACCTGACCCAGGTCCGCCAGGTGCTGAGCAGCGCGATCAAGGACGTGCAGGCCAGCGGTGTCGACCTGAGCAGTCGTCTGGGTGCCAGCAACCGTAAAGCCTCGGCGCACGTGCGCCAGTTGTTGCGGGCGCAGTGG
TRN  11011101101011011
NAM  O32714_KLEPN/10-266
ASQ  LWLNKLAPDAPlMSGLCPSVQVADGQINGENVRFIAVVPDANNHYPRAAGGEVGLLEGWTLAKVVNETIAADADQPVKRPIVAVIDVPSQAYGRREEAFGIHQALAGAAGAYAKARLAGHPVIGLIVGKAMSGAFLAHGYQANRLIAFNDSGVLVHAMGKASAARITLRTVEALEKLAATIPPMAYDVSNYATLGLLSALLDINNPDAPDDHDLSLVSNTLRDAIADA-RTDASLKCRLGAENRRSSQLVRDRMRASW
DSQ  CTGTGGCTGAACAAACTGGCGCCCGACGCGCCGctgATGAGCGGCCTGTGCCCTTCCGTCCAGGTGGCAGACGGCCAGATTAATGGCGAAAACGTGCGTTTTATCGCCGTGGTCCCGGATGCTAACAACCACTACCCGCGCGCCGCCGGCGGCGAAGTCGGCCTGCTGGAAGGCTGGACGCTGGCGAAAGTGGTTAATGAAACCATTGCCGCCGACGCCGACCAGCCAGTCAAACGGCCGATCGTCGCCGTGATCGATGTGCCAAGCCAGGCCTATGGCCGCCGCGAAGAAGCTTTCGGCATTCACCAGGCGCTGGCCGGGGCGGCTGGCGCTTATGCCAAAGCCCGTTTGGCCGGCCACCCGGTAATTGGCCTGATCGTCGGCAAAGCGATGTCCGGGGCGTTTCTGGCCCACGGCTACCAGGCCAACCGCCTGATCGCCTTTAACGATAGCGGCGTGCTGGTCCACGCGATGGGTAAAGCGTCGGCGGCGCGCATTACGCTGCGTACCGTAGAGGCGCTGGAGAAACTGGCGGCTACCATTCCGCCAATGGCCTACGACGTCAGCAACTATGCGACGCTCGGCCTGCTCTCCGCCCTGCTGGATATTAATAATCCGGATGCCCCTGACGACCACGATCTGTCGTTGGTCAGCAACACGCTGCGCGACGCCATCGCTGATGCG---CGCACCGATGCCTCACTGAAGTGCCGCCTGGGCGCGGAAAACCGCCGCAGCTCGCAACTGGTTCGCGATCGCATGCGCGCCAGCTGG
TRN  11011101101011001
NAM  Q93L25_BURCE/5-230
ASQ  ALAEALFGR--.HHGMEADGDFLHGEPRF-DGQPLTVIGTTN-------HAPIGVELALAQARVVLDTV----AERPGQPILLLIDTQGQQLRRRDELLGINRAMAHLGACIDLARRSGHAVIALVYDQALSGGFITSGLIADACYALP--EAEIRVMRIPAMSRVTKLPEEMLTALSQSNPVFAPGVGNYIAMGGVRALWQGDLAAALRSALAQTGTE-------DR--------RACDGGERGGRTLAAGIAQRVL
DSQ  GCACTCGCCGAAGCCCTCTTCGGCAGG------...CATCACGGCATGGAGGCCGATGGCGACTTCCTGCACGGCGAGCCACGTTTC---GACGGCCAGCCACTCACCGTGATCGGCACCACGAAC---------------------CATGCGCCGATCGGCGTCGAGTTGGCGCTGGCGCAGGCCCGCGTGGTGCTCGACACCGTC------------GCCGAGCGGCCGGGCCAGCCGATCCTGCTGTTGATCGACACCCAGGGCCAGCAACTGCGCCGGCGCGACGAACTGCTCGGCATCAACCGCGCGATGGCGCACCTGGGCGCCTGCATCGACCTGGCGCGGCGCAGCGGGCACGCGGTGATCGCGCTGGTCTACGACCAGGCGCTGTCGGGCGGCTTCATCACCTCGGGGCTGATCGCCGACGCCTGCTACGCGCTGCCC------GAGGCCGAGATCCGCGTCATGCGCATTCCCGCCATGTCGCGCGTCACCAAGCTGCCCGAGGAGATGCTGACCGCGCTGTCGCAGTCGAACCCGGTGTTCGCGCCCGGCGTCGGCAACTACATCGCGATGGGGGGCGTGCGCGCGCTGTGGCAGGGCGATCTCGCGGCGGCGCTTCGAAGCGCGCTGGCACAGACCGGCACCGAG---------------------GACCGT------------------------CGGGCCTGCGATGGCGGTGAGCGCGGTGGCCGCACGCTGGCGGCGGGCATCGCCCAGCGCGTGCTG
TRN  10010101100011011
NAM  Q8P4U4_XANCP/5-230
ASQ  ALFDQLFPL--.GHAIACHDDVLTGSATT-AAGEVTVIGTAN-------KLEVGVDHALALAATVLAST----RTHPQRPIVMLADTAGQRLARGDELLGINGYFAHLAKSLDLARARGARLVTLVYGESVSGGFLSFGLMADHIHALP--DAQIRVMDLRAMARVTKQTVDTLQALSKSSPVFAPGVENYVRMGAVESLWDGDLAQALLDALATPSTG-------DQ--------RRTLGAERGGRTLARDVSAAVA
DSQ  GCGTTATTCGACCAGCTGTTTCCGCTG------...GGCCACGCCATCGCCTGCCACGACGATGTGCTGACCGGCAGCGCCACCACC---GCGGCCGGCGAGGTCACCGTGATCGGCACCGCCAAC---------------------AAGCTGGAGGTCGGTGTGGACCATGCGCTCGCCCTGGCTGCCACGGTGTTGGCCAGCACG------------CGCACGCATCCGCAACGGCCGATCGTGATGCTGGCCGACACCGCCGGGCAACGGCTGGCACGGGGTGACGAATTGCTCGGCATCAATGGCTATTTCGCGCATCTGGCCAAGTCGCTCGATCTGGCACGCGCACGCGGCGCACGCCTGGTCACACTGGTGTACGGCGAATCGGTGAGCGGCGGGTTTCTGTCGTTCGGCTTGATGGCCGATCACATCCACGCTCTGCCG------GATGCGCAGATCCGCGTGATGGATCTGCGTGCGATGGCGCGCGTAACCAAGCAGACCGTGGACACGCTGCAGGCCTTGAGCAAGAGCTCGCCGGTGTTCGCGCCGGGCGTCGAAAACTACGTGCGTATGGGCGCAGTGGAATCGCTGTGGGACGGCGACCTGGCGCAAGCCTTGCTCGATGCCCTGGCAACGCCCAGCACCGGT---------------------GATCAG------------------------CGGCGGACGCTCGGTGCCGAGCGCGGTGGCCGCACGCTGGCGCGCGATGTCAGCGCCGCCGTGGCA
TRN  11011111101111110
NAM  O54417_ACICA/5-236
ASQ  LLLKQLFPK--.QLDYQINGYVIKGNAET-EAGPVRILGTVN-------AAPINQEIAIELAGEILQLI----QQQNKTPVVFIVDTQGQDLSRADELLCLNRTFAHLASCVDLLRRSGHANLAIIFGQAVSGGFLSYGLMANEVYALS--DSQVKVMDLNAMARVTKIPVEKLKDLSQSSAIFAPGVENFYKMGAINAIWPDLESDWISQALLNQQQQ-LESYITDQ--------RRVVGQQRQGRQLCNSVIEKVA
DSQ  TTACTCTTAAAACAATTATTTCCAAAG------...CAGTTGGACTACCAGATTAATGGTTATGTGATTAAAGGCAATGCTGAAACT---GAAGCGGGACCTGTACGCATTTTAGGTACAGTCAAT---------------------GCTGCACCAATTAATCAGGAAATTGCGATTGAGCTTGCAGGCGAAATTCTGCAATTGATC------------CAACAGCAAAATAAAACACCAGTGGTTTTTATTGTTGATACCCAAGGACAAGACTTGTCACGTGCCGATGAACTGTTGTGCTTAAACCGGACCTTTGCGCATTTGGCATCTTGTGTAGATTTACTGCGTCGCAGTGGTCATGCCAATTTAGCCATTATTTTTGGACAAGCAGTCAGTGGTGGATTCCTGTCTTATGGATTAATGGCAAACGAAGTCTATGCACTCAGT------GATTCACAAGTCAAAGTGATGGACCTGAATGCGATGGCGCGTGTCACCAAAATCCCTGTAGAGAAATTAAAAGACCTGTCGCAAAGTTCAGCCATCTTTGCACCGGGTGTTGAAAATTTCTACAAAATGGGTGCGATCAACGCGATCTGGCCAGATTTGGAGTCAGACTGGATTAGCCAAGCCCTATTAAATCAGCAACAACAG---CTCGAAAGTTATATCACTGACCAG------------------------CGCCGTGTTGTCGGCCAGCAACGCCAAGGTCGTCAGTTGTGTAACTCAGTCATCGAGAAAGTTGCG
TRN  11011101101011000
NAM  Q89XP1_BRAJA/5-233
ASQ  DIIASLFPD--.GHEVSNDNGVLHGSATLRSGGTMLVIGIAN-------RTALGVDEAIRLSAHVLKSI-----GRDSGPILVLVDSDSQRMSKRDELLGLNEFLAHLAKVLIHADMNGRPTIGVLYGHSAAGALLATGLATRVLVGLP--GADPAVMDLPSMAKVTKLSMEALQEKAKSTPVFAPGLSNLAQMGAVHMTWS--NAASLADQLEALLADMPAA--QDR--------RDALGKQRGGRLKAAEIAERVR
DSQ  GACATCATCGCCTCGCTCTTTCCTGAC------...GGCCATGAGGTAAGCAACGACAACGGCGTCCTTCACGGCTCGGCGACGCTGCGATCCGGTGGCACGATGCTGGTGATCGGCATTGCGAAT---------------------CGAACCGCGCTGGGCGTCGACGAGGCCATCAGGCTTTCCGCACATGTCCTGAAGTCGATC---------------GGTCGTGACTCCGGGCCGATCCTGGTGCTCGTCGATAGCGACAGCCAGCGCATGAGCAAGCGTGACGAACTGCTCGGGCTGAACGAGTTCCTCGCACATCTGGCGAAGGTGCTGATCCACGCGGACATGAATGGCCGCCCGACCATCGGCGTCCTGTACGGCCACTCGGCTGCGGGCGCGCTGCTTGCGACAGGCCTTGCAACGCGTGTGCTGGTCGGACTGCCC------GGAGCCGATCCCGCAGTGATGGATCTGCCTTCGATGGCGAAGGTGACCAAGCTGTCGATGGAGGCGCTACAGGAAAAGGCGAAGTCGACGCCGGTGTTCGCGCCGGGCCTGTCCAATCTCGCGCAAATGGGTGCCGTTCACATGACATGGAGC------AATGCCGCATCGCTCGCCGACCAGCTGGAGGCGTTGCTCGCCGACATGCCGGCCGCG------CAGGACCGG------------------------CGGGATGCGCTCGGCAAGCAGCGTGGCGGCCGGCTGAAGGCCGCCGAGATCGCGGAGCGCGTTCGT
TRN  10010101100011011
NAM  Q89UY5_BRAJA/5-233
ASQ  DILAGLFPN--.GRKIETTGAMIAGQATLPDGGPIHVLGITQ-------GQPLGVDEAIALAGRVIEII----KSNDRAPILVLVDSASQRMSKRDELLGLSEYLSHLAKALLLAEAEGHRTVGLLYGGSAAGAFIATALATGTLVALP--GAHPAVMDLPSMARVTKLPIEVLKAKAEATPVFAPGLDNMVRTGGIHVVWD--ETAPLAPQLAAVLAQ-PAG--RDE--------RSRLGAERGGRRKAAEIADRVV
DSQ  GACATCCTGGCCGGCCTGTTCCCGAAC------...GGCCGAAAGATCGAAACGACCGGCGCGATGATCGCGGGACAGGCGACCTTGCCTGACGGCGGGCCGATCCACGTGCTCGGCATCACGCAA---------------------GGACAGCCGCTCGGCGTGGACGAGGCGATCGCGCTCGCAGGGCGCGTGATCGAGATCATC------------AAATCCAACGATCGGGCGCCTATCCTGGTCCTGGTGGATTCCGCCAGCCAGCGCATGAGCAAGCGCGACGAACTGCTCGGCCTCAGCGAATATCTATCGCATCTCGCCAAGGCCCTGCTGCTGGCAGAGGCCGAGGGACACCGCACGGTCGGCCTGCTCTACGGCGGCAGCGCAGCCGGCGCGTTCATCGCCACCGCTCTTGCCACCGGCACGCTGGTGGCGCTTCCC------GGCGCGCATCCCGCCGTGATGGATCTGCCCTCGATGGCGCGGGTCACCAAGCTTCCGATCGAGGTGCTGAAGGCCAAGGCGGAAGCGACACCCGTTTTCGCGCCCGGGCTCGACAACATGGTCCGCACCGGCGGCATTCACGTCGTCTGGGAC------GAAACTGCGCCCCTGGCGCCGCAGCTTGCGGCCGTGCTGGCGCAG---CCTGCCGGA------CGGGACGAA------------------------CGCAGCCGGCTCGGCGCGGAGCGGGGCGGACGCCGGAAGGCGGCCGAGATCGCCGATCGGGTCGTC
TRN  11011101101011011
//