EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06804 - Lipoprotein_18)
FAM  PF06804
PID  Lipoprotein_18
DES  NlpB/DapX lipoprotein
IPR  IPR010653
ANO  6
ALN  342
AID  0.39552
APH  (Q9KQ48_VIBCH/7-337:0.16488,(Q87MI3_VIBPA/7-338:0.16362,Q8DBA9_VIBVU/7-337:0.13280):0.07229,(Q9CLZ8_PASMU/4-336:1.19905,(NLPB_ECOLI/12-343:0.24759,Q8D0Y2_YERPE/13-345:0.24456):0.51835):0.71109);
ATP  (Q9KQ48_VIBCH/7-337,(Q87MI3_VIBPA/7-338,Q8DBA9_VIBVU/7-337),(Q9CLZ8_PASMU/4-336,(NLPB_ECOLI/12-343,Q8D0Y2_YERPE/13-345)));
ATL  3.45423
DNO  6
DLN  1026
DID  0.486129
DPH  (Q9KQ48_VIBCH/7-337:0.17570,(Q87MI3_VIBPA/7-338:0.20307,Q8DBA9_VIBVU/7-337:0.17157):0.08343,(Q9CLZ8_PASMU/4-336:0.76379,(NLPB_ECOLI/12-343:0.23270,Q8D0Y2_YERPE/13-345:0.28309):0.29941):0.38068);
DTP  (Q9KQ48_VIBCH/7-337,(Q87MI3_VIBPA/7-338,Q8DBA9_VIBVU/7-337),(Q9CLZ8_PASMU/4-336,(NLPB_ECOLI/12-343,Q8D0Y2_YERPE/13-345)));
DTL  2.59344
RID  0.39552
RPH  (Q9KQ48_VIBCH/7-337:0.16488,(Q87MI3_VIBPA/7-338:0.16362,Q8DBA9_VIBVU/7-337:0.13280):0.07229,(Q9CLZ8_PASMU/4-336:1.19905,(NLPB_ECOLI/12-343:0.24759,Q8D0Y2_YERPE/13-345:0.24456):0.51835):0.71109);
RTP  (Q9KQ48_VIBCH/7-337,(Q87MI3_VIBPA/7-338,Q8DBA9_VIBVU/7-337),(Q9CLZ8_PASMU/4-336,(NLPB_ECOLI/12-343,Q8D0Y2_YERPE/13-345)));
RTL  3.45423
LNK  NLPB_ECOLI/12-343:P21167:X57402
LNK  Q87MI3_VIBPA/7-338:Q87MI3:BA000031
LNK  Q8D0Y2_YERPE/13-345:Q8D0Y2:AE013745
LNK  Q8DBA9_VIBVU/7-337:Q8DBA9:AE016803
LNK  Q9CLZ8_PASMU/4-336:Q9CLZ8:AE006146
LNK  Q9KQ48_VIBCH/7-337:Q9KQ48:AE004287
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9KQ48_VIBCH/7-337
ASQ  LVLGSLAVLVLSACSSSPTQRRQAKDDFDYLETTEFKPWVLP----QGATPQFYPNYDIPQGAFHGGVGNVVDIRPPQQVLELIPGARAER.QNGEVTLWMLRQDEAQ-KVWDTALKMIAERKIPLRKQTDSM--VETDWVDWVSEDEDVTIGSRYLMSMVETNNRYGFKISLIGWRENGQVQTVSTTNKERYNAFMTNLVTTRYDSDVRAEAARRAQELVKQIPITMGSDRSGFPVIIARTPYDVLWQRLPELLPKMGFTIEERNQSQGTVKAKYAAPDDEFWQQVGVKP---IELKSGTYTFLFGDLGNRTSINVTDSAGKPVNEALLKEMVPVLSAVVD
DSQ  CTAGTTCTCGGTTCACTGGCTGTTTTGGTTTTAAGTGCTTGCTCCAGCAGCCCCACGCAACGACGCCAAGCCAAAGACGATTTCGACTATCTCGAAACCACAGAATTTAAGCCTTGGGTTTTGCCA------------CAAGGTGCCACTCCGCAGTTTTATCCTAACTATGATATTCCGCAGGGGGCGTTTCATGGTGGCGTGGGCAATGTGGTCGATATTCGCCCGCCACAACAAGTGTTGGAACTCATCCCTGGTGCTCGCGCAGAACGT...CAAAATGGCGAAGTGACCTTATGGATGTTGCGCCAAGATGAAGCGCAA---AAAGTGTGGGATACCGCACTGAAAATGATTGCGGAGCGCAAAATCCCTCTTCGTAAGCAAACCGATTCTATG------GTGGAAACGGACTGGGTCGATTGGGTATCAGAAGATGAAGATGTGACGATTGGTAGCCGCTACTTAATGTCGATGGTGGAAACCAATAATCGTTATGGCTTTAAAATTTCGCTGATTGGTTGGCGTGAAAATGGTCAAGTGCAAACGGTCAGTACCACCAATAAAGAGCGTTACAACGCCTTTATGACCAACTTGGTCACCACTCGTTACGACTCCGATGTGCGTGCGGAAGCGGCGCGCCGTGCCCAAGAGCTGGTTAAGCAAATTCCGATTACCATGGGCTCAGATCGCAGTGGATTCCCTGTGATCATTGCGCGTACGCCTTACGATGTACTGTGGCAACGTTTGCCAGAGTTACTGCCCAAAATGGGCTTTACTATTGAAGAGCGTAACCAGTCACAAGGTACGGTCAAAGCCAAATACGCTGCACCAGATGATGAATTCTGGCAACAGGTTGGTGTTAAACCG---------ATTGAGCTTAAATCCGGGACTTACACCTTCCTCTTTGGTGACTTGGGTAACCGTACGTCGATTAACGTGACCGACTCAGCGGGTAAACCGGTCAACGAAGCGCTGTTGAAAGAGATGGTGCCAGTGCTCTCAGCAGTGGTGGAT
TRN  11011101101011000
NAM  Q8DBA9_VIBVU/7-337
ASQ  LVLSSLAVFVLSACSGSATQRRQAKDDFAYLETPPLEQWQLP----EGATPQFYPNYNIPQGEFAGGIGKQVDIRPPQQILELIPGARYER.SQGEVTLWLIKQEEAD-EVWQTVKDMLAERQIPIDMQSDTH--IETGWVTWRSEDEEMEIGSRYAIDRFEANNRHGFKINLVDWREGTELKPVTLTNKERYNVFMTNLVTSQYDQVKRDEAQRRAQELVKQIPITMGTDRSGFPVIIARTPYNVLWQRLPTILPQMGFTIDERNQSQGTIKAKYASPDDEFWNEIGVKP---MELKSGTYTFLFGDLGNRTSINVTDSSGKPVEEAFLKSMAPVLAAVVK
DSQ  TTAGTGCTTAGCTCGCTGGCTGTTTTTGTTTTGTCTGCCTGTTCTGGTAGCGCCACACAACGCCGTCAGGCAAAGGATGACTTTGCTTACCTAGAAACACCACCACTTGAGCAGTGGCAATTACCT------------GAAGGGGCAACCCCTCAATTTTATCCAAATTACAATATCCCTCAGGGTGAGTTTGCGGGTGGCATTGGTAAGCAAGTGGATATCCGTCCACCTCAGCAAATTTTAGAATTGATCCCGGGTGCACGTTATGAGCGC...AGTCAGGGAGAAGTCACGCTTTGGCTGATCAAGCAAGAAGAAGCGGAT---GAAGTGTGGCAAACGGTGAAAGATATGCTGGCTGAGCGTCAAATTCCGATCGACATGCAATCCGATACTCAC------ATCGAGACGGGTTGGGTTACGTGGCGCTCTGAAGATGAAGAGATGGAAATCGGTAGCCGATATGCAATTGATCGCTTCGAAGCAAACAATCGTCATGGTTTTAAAATCAATTTGGTTGATTGGCGAGAAGGCACTGAGCTTAAGCCGGTAACGCTTACCAATAAAGAGCGCTACAATGTGTTTATGACCAATTTGGTGACGTCTCAGTACGACCAAGTCAAACGCGATGAAGCGCAGCGTCGAGCTCAGGAATTGGTGAAGCAAATCCCTATCACGATGGGTACCGATAGAAGTGGTTTCCCGGTCATCATTGCACGTACTCCGTACAATGTGCTCTGGCAGCGTCTTCCTACGATTCTTCCGCAAATGGGTTTCACGATTGACGAGCGCAACCAATCTCAAGGCACCATCAAAGCGAAATACGCCTCGCCGGATGATGAATTCTGGAATGAAATCGGTGTGAAGCCG---------ATGGAGCTCAAGTCAGGCACTTACACATTCTTGTTTGGTGATTTGGGTAACCGTACATCCATTAACGTGACCGATTCTTCGGGTAAACCGGTTGAGGAAGCGTTTTTGAAATCGATGGCACCCGTCTTAGCCGCGGTGGTTAAG
TRN  10010101100011000
NAM  Q87MI3_VIBPA/7-338
ASQ  LVLSSLAVFVLTACSGGANQRRQAKDDFEYLNTPALEAWNVP----QGAQPQFYPNYDIPQGNYAGGLGKSVDIRPPQQVLELIPGARLDRsSNGEVTLWLLRKDELD-KVWQTVQGMVEARKIPVESQTDSR--IETGWVTWNSPDEELEIGSRYEISRAEANGRHGFKVSLIDWREGDQVKEVTATNRERYNVFMTNLVTARYDQEVREEAQRKAQELVKQIPVTMGKDRSGLPVIIARAQYNVLWQRLPNILPKMGFTIEERSQSQGTVTAKYASPDDEFWNEIGVKP---IDLKAGKYTFLLGDLGNRTSINITDPSGKPVEEEFLKSLVPVLGAVVK
DSQ  TTAGTGTTAAGTTCATTAGCTGTATTCGTATTGACTGCCTGTTCAGGTGGTGCCAACCAACGTCGTCAAGCAAAAGACGATTTCGAGTATTTGAACACACCAGCTCTAGAGGCATGGAACGTTCCG------------CAAGGAGCTCAACCTCAGTTCTACCCAAACTATGACATCCCTCAGGGCAATTATGCGGGTGGCTTAGGGAAGTCGGTTGATATCCGTCCACCTCAGCAAGTACTTGAGTTGATTCCTGGTGCGCGCCTAGATCGCagtAGTAACGGTGAAGTGACACTTTGGTTATTGCGCAAAGATGAGCTAGAT---AAAGTTTGGCAAACTGTGCAAGGCATGGTTGAAGCAAGAAAAATTCCAGTGGAAAGCCAAACCGATTCTCGA------ATCGAGACAGGTTGGGTAACGTGGAACTCTCCTGACGAAGAGCTAGAAATTGGTAGCCGATACGAGATCTCTCGTGCAGAAGCAAATGGTCGACACGGTTTCAAAGTGAGCTTAATTGACTGGCGTGAAGGCGATCAAGTTAAGGAAGTGACTGCGACTAACCGCGAGCGTTACAACGTGTTCATGACTAACTTAGTAACGGCTCGTTACGATCAAGAAGTTCGTGAAGAAGCACAGCGTAAAGCTCAAGAGTTGGTGAAACAGATTCCTGTCACGATGGGCAAAGACCGCAGTGGTCTGCCAGTTATCATCGCTCGTGCGCAATACAATGTATTGTGGCAGCGTTTACCGAACATTCTGCCTAAGATGGGCTTCACTATTGAAGAGCGCAGCCAGTCACAAGGTACGGTAACAGCGAAGTATGCATCTCCAGATGATGAATTCTGGAATGAAATTGGCGTGAAACCA---------ATCGACCTAAAAGCAGGTAAATACACTTTCTTGCTAGGGGACTTGGGCAACCGCACTTCTATCAACATTACCGATCCATCAGGCAAACCTGTTGAAGAAGAGTTCTTGAAATCGTTGGTGCCAGTTCTTGGTGCGGTGGTGAAA
TRN  10010101100011000
NAM  Q8D0Y2_YERPE/13-345
ASQ  KVVGVSLVMLLAACSTDQRYKRQVSGDESYLTAPGLKPLNAP---SGMILPVQNGEFDVRTVNSQGAVGKQLDIRPPVQPLTLLSGSRAEN.-ATDTSKLLLENSPQNRDLWAQVTRVLQDHNWPIASRQDASQTLTTDWIKWNRADEDVQFEGRYQISVQEQGYQLALVVKSLELQQ-GGKTITQYSEIQRYNSAMLNAIIEGLDKVRADSESSQASRKVGTLDVQSGSDDTGLPLLIVRAPYAVVWERLPAALEKVGMKVTDRSRPQGTVSVTSKSLSSSSWDALGAKD---PELPEGDYKLQVGDLDNRSSLQFIGPKGHTLTQAQNDALVAVFQAAFS
DSQ  AAAGTTGTAGGTGTTTCGCTGGTGATGTTACTGGCCGCCTGCTCGACGGACCAACGCTACAAACGCCAGGTGAGTGGTGACGAGTCTTATCTTACAGCGCCAGGGCTAAAGCCGCTTAACGCACCA---------TCAGGTATGATCCTGCCGGTACAAAATGGTGAGTTTGATGTCCGCACCGTTAATTCGCAAGGCGCTGTGGGCAAACAGTTGGATATTCGTCCACCGGTACAACCACTGACATTATTGAGTGGCTCCCGCGCCGAAAAT...---GCAACCGATACCAGCAAGCTATTGTTAGAGAATAGCCCGCAAAACCGCGATCTGTGGGCTCAGGTTACTCGTGTCCTGCAAGATCATAACTGGCCAATAGCCAGCCGTCAGGATGCCAGCCAAACGCTGACCACTGATTGGATCAAATGGAACCGGGCAGATGAAGATGTACAGTTCGAAGGCCGTTACCAGATAAGTGTGCAGGAGCAAGGTTATCAGCTGGCATTAGTAGTGAAATCCCTTGAGTTACAACAA---GGGGGGAAAACCATCACTCAGTATAGCGAGATCCAGCGCTATAACAGCGCAATGCTGAATGCCATTATCGAAGGTTTGGATAAAGTGCGGGCTGACAGCGAGAGCAGTCAGGCCTCACGTAAAGTCGGTACGCTGGATGTACAAAGTGGCAGTGACGATACTGGCTTGCCTCTGCTGATTGTCCGTGCCCCTTATGCGGTTGTCTGGGAACGTCTGCCTGCTGCGCTTGAGAAAGTTGGCATGAAAGTGACCGACCGCAGCCGTCCGCAAGGTACTGTCAGCGTCACCAGTAAATCGCTGAGTAGCAGTAGCTGGGACGCACTGGGTGCCAAAGAT---------CCTGAATTGCCAGAAGGCGATTATAAGTTACAGGTCGGTGACCTTGATAACCGCAGTAGCTTACAGTTCATTGGTCCGAAAGGGCATACCTTAACCCAGGCGCAGAATGATGCGTTGGTTGCGGTATTCCAGGCAGCGTTTAGC
TRN  10010101100011000
NAM  NLPB_ECOLI/12-343
ASQ  KVAGVSLVLLLAACSSDSRYKRQVSGDEAYLEAAPLAELHAP---AGMILPVTSGDYAIPVTNGSGAVGKALDIRPPAQPLALVSGARTQF.-TGDTASLLVENGRGN-TLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQ-AGKPVADAASMQRYSTEMMNVISAGLDKSATDAANAAQNRASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLSDSDWQELGASD---PGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFS
DSQ  AAGGTTGCGGGTGTTTCGCTTGTTTTATTACTCGCTGCCTGTAGTTCTGACTCACGCTATAAGCGTCAGGTCAGTGGTGATGAAGCCTACCTGGAAGCGGCACCGCTTGCGGAGCTTCATGCCCCG---------GCTGGAATGATTTTGCCGGTGACCTCCGGTGATTATGCAATCCCGGTGACCAACGGTAGTGGTGCTGTCGGTAAGGCGCTGGACATTCGTCCACCAGCCCAGCCGCTGGCACTGGTTTCTGGCGCGCGTACCCAGTTC...---ACGGGCGATACCGCTTCATTGCTGGTGGAAAATGGTCGTGGCAAT---ACTCTGTGGCCGCAGGTGGTTAGCGTGCTGCAGGCGAAAAACTACACCATCACCCAACGTGATGATGCTGGTCAGACACTGACCACCGATTGGGTACAATGGAACCGTCTGGACGAAGACGAGCAGTATCGTGGTCGTTATCAAATCTCTGTTAAGCCGCAGGGTTATCAGCAGGCGGTTACGGTTAAACTGCTGAACCTGGAACAG---GCGGGCAAACCGGTTGCAGACGCGGCTTCCATGCAGCGTTACAGCACGGAGATGATGAACGTTATTTCCGCCGGTCTGGATAAATCTGCCACTGACGCCGCGAACGCTGCGCAAAATCGTGCCTCCACCACTATGGACGTACAAAGTGCAGCTGATGACACCGGTTTACCAATGCTGGTCGTACGCGGGCCGTTCAATGTGGTTTGGCAACGTCTGCCAGCGGCGCTGGAAAAAGTGGGCATGAAAGTGACCGACAGCACCCGTTCGCAGGGCAACATGGCCGTAACTTATAAGCCGCTGTCTGACAGCGACTGGCAGGAACTGGGCGCGAGCGAT---------CCAGGCCTGGCATCCGGTGACTATAAACTGCAGGTTGGCGATTTAGATAACCGCAGCAGCCTACAGTTCATCGATCCGAAAGGTCATACTCTGACTCAGAGTCAGAACGACGCGCTGGTAGCTGTCTTCCAGGCTGCGTTTAGC
TRN  11011101101011000
NAM  Q9CLZ8_PASMU/4-336
ASQ  WLFPFAFVATLAGCSVSNESKQQAND--TYQKSDAALPLFAPLNTAGVSLPKQDTTYQLPQVKVKKA--DQVDIRPPETPLAIIQNSIAQF.-DGERALIAYPIDKREVYNLQQVARLLKEQGIGYQLTNEK---IVTDWAPTGRADEIGDTQVRYEIEQVSSGNYSALFVSILQMKRNEVVFSPHLADKQRYSSDRLNQLVGELDASYRKQVRDLNNSGLMPIQSVLGTDSNGRTALVLGAPFNHAWTKLGQVLPQLEFDIKDEIIGRGVRELKYRPAGAKSWWWPFGRAEGSSGLKTGTYFMQLSALGKQSAVVMTDDDGNALSGEQAQALYQALQNLLA
DSQ  TGGTTATTCCCTTTTGCTTTCGTTGCAACCTTGGCAGGTTGCTCAGTGAGCAATGAAAGTAAACAGCAAGCCAATGAT------ACTTATCAAAAATCAGATGCGGCCTTACCGCTGTTCGCCCCTTTGAACACCGCTGGCGTGAGCTTGCCAAAGCAGGATACCACTTATCAACTTCCTCAAGTGAAAGTGAAAAAAGCG------GATCAGGTGGATATTCGCCCCCCAGAAACGCCTTTAGCGATTATTCAAAATTCTATTGCACAATTT...---GATGGTGAACGGGCATTAATTGCTTATCCGATTGATAAAAGAGAGGTTTATAACCTGCAACAAGTCGCACGTTTATTAAAAGAGCAGGGGATTGGTTATCAGTTAACGAATGAGAAA---------ATTGTGACAGATTGGGCTCCAACGGGACGTGCGGATGAGATTGGGGACACGCAAGTACGTTATGAAATTGAGCAAGTGAGTTCTGGCAATTATAGCGCACTGTTTGTCTCCATTTTACAGATGAAACGTAATGAGGTGGTATTTAGTCCACATTTAGCGGATAAACAACGTTATAGTTCTGATCGCTTGAACCAACTTGTTGGTGAATTAGATGCGTCTTACCGTAAACAAGTTCGTGATTTGAATAACAGCGGATTGATGCCAATTCAGTCTGTATTAGGTACGGACAGTAATGGACGTACTGCTCTCGTGTTAGGGGCACCCTTTAATCATGCGTGGACAAAACTAGGACAAGTGTTACCGCAGCTTGAATTTGATATTAAAGATGAAATTATTGGTCGCGGGGTAAGGGAGTTAAAATACCGTCCAGCTGGAGCAAAAAGTTGGTGGTGGCCATTTGGTCGTGCTGAAGGCAGTAGCGGACTGAAAACAGGTACCTATTTTATGCAGTTAAGCGCCTTAGGGAAGCAAAGTGCGGTGGTGATGACCGATGATGATGGCAATGCGTTATCTGGGGAGCAAGCTCAGGCGCTTTATCAAGCATTACAAAATCTCTTAGCG
TRN  10010101100011000
//