EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06783 - UPF0239)
FAM  PF06783
PID  UPF0239
DES  Uncharacterised protein family (UPF0239)
IPR  IPR009621
ANO  2
ALN  86
AID  0.306667
APH  (MANBL_HUMAN/1-85:1.39783,U239_DROER/6-87:0.31923);
ATP  (MANBL_HUMAN/1-85,U239_DROER/6-87);
ATL  1.71707
DNO  2
DLN  258
DID  0.415638
DPH  (MANBL_HUMAN/1-85:1.13593,U239_DROER/6-87:0.00000);
DTP  (MANBL_HUMAN/1-85,U239_DROER/6-87);
DTL  1.13593
RID  0.306667
RPH  (MANBL_HUMAN/1-85:1.33396,U239_DROER/6-87:0.38311);
RTP  (MANBL_HUMAN/1-85,U239_DROER/6-87);
RTL  1.71707
LNK  MANBL_HUMAN/1-85:Q9NQG1:AL034422
LNK  U239_DROER/6-87:Q9U5Y0:AJ250309
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MANBL_HUMAN/1-85
ASQ  MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKR-
DSQ  ATGGCCTCTGACCTAGACTTCTCACCTCCGGAGGTGCCCGAGCCCACTTTCCTGGAGAACCTGCTACGGTACGGACTCTTCCTGGGAGCCATCTTCCAGCTCATCTGTGTGCTGGCCATCATCGTACCCATTCCCAAGTCCCACGAGGCGGAGGCTGAACCGTCTGAGCCCAGAAGTGCTGAGGTGACGAGGAAGCCCAAGGCTGCTGTTCCTTCTGTGAACAAGAGGCCCAAGAAAGAGACTAAGAAGAAGCGG---
TRN  10010101100011001
NAM  U239_DROER/6-87
ASQ  DSLAAAASLDKYGDEDIFSLLIRYGLYVGALFQFVCISAAVLME----NNPDVNSNPETGEVTEREGEPVRTRLHKIRKLEKKKRR
DSQ  GACAGTCTGGCCGCCGCCGCGTCCCTGGACAAGTACGGGGACGAAGACATCTTCAGCTTGCTAATCCGCTACGGACTTTATGTGGGTGCCCTCTTCCAGTTCGTTTGCATTTCGGCCGCAGTGCTGATGGAG------------AATAACCCGGATGTCAATAGTAATCCGGAGACCGGCGAAGTGACGGAGCGGGAGGGCGAGCCGGTCCGGACACGTCTGCACAAGATCCGGAAGCTGGAGAAGAAGAAGCGACGA
TRN  11011111101111111
//