EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06770 - Arif-1)
FAM  PF06770
PID  Arif-1
DES  Actin-rearrangement-inducing factor (Arif-1)
IPR  IPR010639
ANO  8
ALN  211
AID  0.250887
APH  ((((((Q9YMK9_NPVLD/1-194:1.28371,Q9J8A1_9NUCL/6-200:0.54148):0.16379,Q8JMB0_9NUCL/49-236:0.52751):0.28094,Q8V5P8_9NUCL/7-202:0.85158):0.48642,Q9J1I8_NPVST/7-198:0.91290):1.34645,O92388_NPVBM/19-223:0.56463):0.20279,Y021_NPVOP/19-217:0.37017,Q91GN2_NPVEP/25-222:0.23417);
ATP  ((((((Q9YMK9_NPVLD/1-194,Q9J8A1_9NUCL/6-200),Q8JMB0_9NUCL/49-236),Q8V5P8_9NUCL/7-202),Q9J1I8_NPVST/7-198),O92388_NPVBM/19-223),Y021_NPVOP/19-217,Q91GN2_NPVEP/25-222);
ATL  7.7888
DNO  8
DLN  633
DID  0.400051
DPH  ((((Q9YMK9_NPVLD/1-194:0.60910,(Q8V5P8_9NUCL/7-202:0.62016,(Q8JMB0_9NUCL/49-236:0.48973,Q9J8A1_9NUCL/6-200:0.40095):0.11961):0.13324):0.19651,Q9J1I8_NPVST/7-198:0.51434):0.62864,O92388_NPVBM/19-223:0.44634):0.07046,Y021_NPVOP/19-217:0.22772,Q91GN2_NPVEP/25-222:0.27591);
DTP  ((((Q9YMK9_NPVLD/1-194,(Q8V5P8_9NUCL/7-202,(Q8JMB0_9NUCL/49-236,Q9J8A1_9NUCL/6-200))),Q9J1I8_NPVST/7-198),O92388_NPVBM/19-223),Y021_NPVOP/19-217,Q91GN2_NPVEP/25-222);
DTL  4.73271
RID  0.250887
RPH  ((((((Q9YMK9_NPVLD/1-194:1.28371,Q9J8A1_9NUCL/6-200:0.54148):0.16379,Q8JMB0_9NUCL/49-236:0.52751):0.28094,Q8V5P8_9NUCL/7-202:0.85158):0.48642,Q9J1I8_NPVST/7-198:0.91290):1.34645,O92388_NPVBM/19-223:0.56463):0.20279,Y021_NPVOP/19-217:0.37017,Q91GN2_NPVEP/25-222:0.23417);
RTP  ((((((Q9YMK9_NPVLD/1-194,Q9J8A1_9NUCL/6-200),Q8JMB0_9NUCL/49-236),Q8V5P8_9NUCL/7-202),Q9J1I8_NPVST/7-198),O92388_NPVBM/19-223),Y021_NPVOP/19-217,Q91GN2_NPVEP/25-222);
RTL  7.7888
LNK  O92388_NPVBM/19-223:O92388:L33180
LNK  Q8JMB0_9NUCL/49-236:Q8JMB0:AY126275
LNK  Q8V5P8_9NUCL/7-202:Q8V5P8:AF334030
LNK  Q91GN2_NPVEP/25-222:Q91GN2:AY043265
LNK  Q9J1I8_NPVST/7-198:Q9J1I8:AF216302
LNK  Q9J8A1_9NUCL/6-200:Q9J8A1:AF169823
LNK  Q9YMK9_NPVLD/1-194:Q9YMK9:AF081810
LNK  Y021_NPVOP/19-217:O10280:U75930
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9YMK9_NPVLD/1-194
ASQ  MLEAALGVNLVCAGAAFVGLGVAGARSSAAALLVDF-EDGTDVFDMSADVAVYGALLTAAGALAL---------LSLVPRCRRASACLAMGALLLSISMTMAWLFGLTWLVRYGRVPALDARLRTYDTDRLCWDGLVFAP---PAALNMK---NCFARD-GRVMCALCRSEYYASEATALRKYRTVVALGAIVAFLAQGALLLVLFLAETK
DSQ  ATGCTCGAGGCGGCGTTGGGAGTCAATCTAGTGTGCGCCGGCGCGGCGTTCGTGGGCCTGGGCGTCGCGGGCGCGCGCTCCTCGGCCGCGGCGCTGCTCGTCGACTTC---GAGGACGGCACCGACGTGTTCGACATGAGCGCCGACGTGGCCGTGTACGGCGCGCTCTTGACGGCGGCCGGCGCGCTCGCCCTG---------------------------CTGTCGCTGGTGCCGCGATGCCGGCGCGCGAGCGCCTGTCTGGCCATGGGCGCGCTGCTGCTCTCCATCTCGATGACCATGGCGTGGCTGTTCGGACTGACGTGGCTCGTGCGCTACGGCCGCGTGCCCGCGCTGGACGCGCGGCTGCGCACCTACGACACGGACCGCCTGTGCTGGGACGGACTGGTGTTCGCGCCG---------CCCGCGGCCCTCAACATGAAG---------AACTGTTTCGCGCGCGAC---GGCCGGGTCATGTGCGCGCTGTGCCGCAGCGAGTACTACGCGAGCGAGGCGACCGCCCTGCGCAAGTACCGCACGGTCGTGGCGCTCGGCGCGATCGTCGCCTTTCTCGCGCAGGGCGCGCTGCTGCTGGTGCTGTTTTTGGCCGAGACCAAA
TRN  11011101101011011
NAM  Q9J8A1_9NUCL/6-200
ASQ  LSCIARSILTLVVGVAFAILGIAGISESSYALIIDY-ANGSPVFNCSGFVLVYG--VNLVIVGGG------ILFTDKLHCLQYLLVCLTLLASHATLTVIVLICT-YNWVVEYGHIPALDAYVREHDRKSVCWNGIVRL---DYNSLAFD--TNCYRIA-ETTYCALCRKEYYSDEMTFLKLNRFELAFVLVLLLTLNGYTLWKLHEIYTS
DSQ  CTTAGTTGTATTGCGCGCTCGATCCTCACCCTAGTCGTCGGCGTCGCGTTCGCAATACTGGGCATTGCGGGCATCTCGGAATCTAGCTACGCCCTGATCATAGACTAC---GCCAACGGTTCTCCCGTTTTTAATTGCAGCGGATTCGTGCTCGTCTATGGC------GTAAACCTCGTAATCGTCGGCGGAGGC------------------ATACTGTTCACCGACAAACTACATTGTCTGCAATATTTGCTCGTGTGTTTAACGTTGTTGGCGTCGCACGCGACGTTGACGGTGATAGTGCTCATCTGCACG---TACAATTGGGTCGTCGAGTACGGCCACATCCCCGCGCTCGACGCCTACGTGCGCGAACACGACCGCAAATCGGTGTGTTGGAACGGCATAGTGCGTCTC---------GATTACAACAGCCTCGCTTTCGAC------ACAAACTGCTATCGAATCGCC---GAAACTACATATTGCGCACTATGCAGGAAGGAATATTACAGCGATGAGATGACCTTTTTAAAATTGAACCGATTCGAGTTGGCGTTTGTTTTGGTGCTGCTGTTGACGCTAAACGGATACACGTTGTGGAAATTGCACGAAATTTACACTTCG
TRN  10010101100011010
NAM  Q8JMB0_9NUCL/49-236
ASQ  LSCIVLSTTLNVIGCIAVTIGCMGMINPNAALIIDY-ENGTGMFNCSGFVFVYG--VLLICVGLG---------IVFLPKLPWHLAT----TLLCLIIIVCLCT--LSWIVRYGHVAILDVHVREHDVSASCWGGVYVN---DFNNIQVPQ-TNCFFAG-SKMYCVRCRNEYYRDEPTFVRTYRFTIVFVMLALLALNAWSFAVSYKKYIA
DSQ  CTTAGTTGTATCGTGCTTAGCACGACGCTCAACGTAATCGGCTGCATTGCTGTAACTATAGGTTGTATGGGAATGATAAATCCCAATGCGGCATTGATCATCGATTAT---GAAAATGGAACGGGCATGTTTAACTGCAGCGGTTTCGTATTCGTCTATGGC------GTGTTGCTGATCTGCGTCGGACTGGGC---------------------------ATAGTGTTTTTGCCAAAGCTACCTTGGCATTTGGCCACG------------ACGCTGCTGTGTTTAATAATCATCGTATGCCTGTGCACT------TTGAGCTGGATTGTTCGTTACGGACACGTGGCAATATTAGATGTTCACGTGCGCGAACACGATGTTAGCGCGTCATGTTGGGGCGGTGTCTATGTAAAT---------GATTTCAATAATATACAAGTTCCACAA---ACCAATTGTTTTTTTGCTGGT---TCAAAAATGTATTGTGTGAGGTGTCGTAATGAATATTATCGCGATGAACCTACGTTTGTGCGCACATACAGATTTACAATCGTATTTGTGATGCTTGCGTTGCTGGCATTGAATGCGTGGTCGTTTGCCGTGTCGTATAAAAAGTACATAGCG
TRN  10010101100011000
NAM  Q8V5P8_9NUCL/7-202
ASQ  LQLIFFSVLG--IGCTLF--GMYGIFDTDWAVQLDYGLVSVAPYNCSNLLCAYGFMLCLACIFSV---------ITSKVNSTWPLVFAFYFTLLCAIIVMCLLTM-LEMFVQHGHIGALDVHYRNYDIDKTCWKGIVEYKQVDSNSIVVDMPLNCYEIK-YQIFCASCRNVYKPYEATFFKNHRITVYIALGTIFTWHCLCLIQLLNKYVR
DSQ  TTACAATTAATATTTTTTAGTGTTTTAGGT------ATTGGTTGTACGTTATTT------GGCATGTACGGTATATTCGACACGGACTGGGCGGTTCAACTCGATTATGGCCTCGTCAGTGTCGCTCCGTATAATTGTTCAAATTTATTATGCGCATACGGATTCATGTTGTGTTTAGCGTGTATATTTTCTGTT---------------------------ATTACATCAAAAGTCAACTCGACATGGCCATTAGTCTTTGCATTCTATTTTACGTTGTTATGTGCAATAATAGTAATGTGTTTGTTAACTATG---CTGGAAATGTTCGTACAACACGGACACATTGGAGCGCTCGACGTGCATTATCGCAACTACGACATCGACAAAACCTGTTGGAAAGGAATCGTCGAATACAAACAAGTGGACTCAAATAGTATTGTCGTGGACATGCCGCTGAATTGTTACGAAATAAAA---TATCAAATATTTTGCGCTTCATGTCGCAACGTGTACAAACCGTACGAAGCGACTTTTTTCAAAAATCATCGTATCACTGTGTACATCGCGCTTGGCACGATCTTCACCTGGCACTGTTTGTGTTTAATACAATTGCTCAACAAATATGTTAGA
TRN  10010101100011000
NAM  Q9J1I8_NPVST/7-198
ASQ  TVHLILIVFMLATASLCVAFGILGVIDERFEPTLDY-ENGYGAQTVVYLMLAYGSLLALVTVVGS--------IGYFSRIKRFMHVAVPIAVFLAVLQISMFMS--IASVSQHLHLPIVDAAYRDHDKDSVCWTGLERRK--FINDSNAN---NCCVRK---MMCVECRSEYVCDETTFAKQHYWTLFVLAAISVMANFLFIQNMFDRLCR
DSQ  ACCGTTCATTTGATCCTAATCGTGTTCATGCTGGCGACGGCGTCGCTGTGTGTAGCATTTGGGATATTGGGCGTGATCGACGAACGGTTCGAGCCGACGCTTGACTAC---GAAAATGGTTACGGCGCCCAGACGGTCGTTTATCTCATGCTGGCGTATGGATCGTTGCTGGCTCTCGTCACTGTCGTCGGATCG------------------------ATTGGGTACTTTTCGAGAATCAAACGTTTTATGCACGTGGCCGTGCCGATAGCCGTTTTCCTCGCCGTCTTGCAAATATCAATGTTCATGTCT------ATCGCGTCCGTGTCGCAGCATTTACATTTACCTATCGTCGACGCTGCGTATAGAGACCACGACAAGGACAGCGTCTGTTGGACGGGACTCGAAAGGCGTAAA------TTTATCAACGACAGCAATGCGAAC---------AACTGTTGTGTGCGCAAA---------ATGATGTGCGTCGAATGTAGATCAGAGTATGTGTGCGACGAGACGACTTTTGCGAAACAACACTACTGGACCCTGTTCGTTTTGGCCGCGATCAGCGTTATGGCAAATTTTCTCTTTATACAAAACATGTTTGACAGACTCTGTCGA
TRN  10010101100011000
NAM  Q91GN2_NPVEP/25-222
ASQ  TVHIVVFVFS-LMGTVNQKYALLLELNDG-VSVLNISLLTAFMWGPYVLIAITYYMYKIILYFKK----------LSMKCDFYIKSVIIVVNVLALICWLLFVIF-QPQIYQHGHVPVLDVMYREYDLDSLCWSNVYVEKYDAHDTNAIVTDRNCVYQHNFIKKCIGCRIEVQHDEPTVFNQNPSALIMMTLTIIIIFCWNMYVQQKEMRT
DSQ  ACAGTGCATATAGTTGTGTTTGTGTTCTCG---CTAATGGGTACTGTTAATCAAAAATATGCGCTTTTGTTGGAACTAAACGACGGA---GTATCGGTGCTAAATATTTCGTTGCTGACGGCGTTTATGTGGGGACCGTACGTGCTGATCGCCATTACCTACTACATGTACAAAATAATTTTGTACTTTAAAAAG------------------------------TTATCTATGAAATGTGACTTTTACATTAAAAGTGTGATAATAGTTGTCAACGTGTTGGCATTAATCTGCTGGTTGCTGTTTGTCATATTC---CAACCTCAAATCTACCAACACGGCCACGTGCCCGTGCTTGACGTTATGTATAGAGAATACGACCTAGATTCTTTGTGCTGGAGCAACGTGTATGTGGAAAAATATGACGCGCACGACACGAACGCCATTGTCACCGATCGCAATTGTGTGTACCAGCATAATTTTATAAAAAAATGTATTGGGTGTCGCATTGAAGTGCAACACGATGAGCCAACTGTATTTAATCAGAATCCAAGTGCGCTAATCATGATGACATTGACAATTATAATTATTTTTTGTTGGAACATGTACGTGCAACAAAAAGAAATGCGCACT
TRN  10010101100011010
NAM  Y021_NPVOP/19-217
ASQ  GLCSFAFVFA-LMATVTARYAFLLELEDSAHSIINLSHLAAFLLGPYVLATITWAMYKMLLCYKG----------LEMRSNFYMKTVVALAHLMAGSCWLLFVVF-QPQIHKNGHVPVLDALIRHHDRQSLCWSGVVVQEYEVHDANAIRTDLNCVYYDNFMKKCVGCRMEVRHDEPTVFNQNQGALTMLALLAIVMHCWNMYVQQKETRR
DSQ  GGGCTTTGCTCGTTCGCGTTCGTGTTCGCG---TTAATGGCCACCGTAACTGCTAGATACGCGTTTCTGCTGGAGCTCGAAGACTCCGCCCACTCAATCATCAACTTGTCACATTTGGCCGCGTTTTTGCTGGGGCCGTACGTGCTGGCCACCATCACGTGGGCCATGTACAAGATGCTGCTGTGCTACAAGGGT------------------------------TTGGAGATGCGCAGCAATTTTTACATGAAGACTGTAGTTGCGCTGGCCCACCTGATGGCGGGCAGCTGCTGGTTGCTGTTTGTGGTGTTT---CAGCCACAGATACACAAAAACGGACACGTTCCCGTGCTGGACGCCTTGATAAGACACCACGACCGCCAATCGTTGTGCTGGAGCGGCGTTGTGGTGCAGGAGTATGAGGTGCACGACGCCAACGCCATCCGCACCGACCTCAATTGTGTGTATTATGACAATTTCATGAAAAAGTGTGTGGGGTGCAGAATGGAGGTCAGGCACGACGAGCCCACCGTGTTCAATCAAAACCAGGGCGCGCTGACCATGCTGGCGCTCCTGGCAATCGTGATGCATTGTTGGAACATGTATGTGCAACAGAAGGAAACGCGTCGC
TRN  10010101100011000
NAM  O92388_NPVBM/19-223
ASQ  LAYLIVFVLS-IMGVADNRYAFLLEIEGK-RSVINLSIPIMLSFGMWILFYTFYFVWKIVVWTKNRIGSSNTNVNFNAEKNFYVAITCIMVNVITGLCWMLFAAF-QIYVFKNGHLPTLDVLYRHYDLESVCWNSIVYLEIDYENAEILS--QNCVYEN-LYKKCIMCRAIVRDHEPTVFNQNYSVIIMGVLTILAVQCWNLYVQLKEMRR
DSQ  TTAGCATATCTGATAGTGTTTGTGTTATCT---ATAATGGGAGTGGCGGACAACAGATACGCGTTTTTGCTGGAAATTGAAGGAAAG---CGATCGGTTATCAATCTATCTATACCGATAATGCTGTCGTTCGGCATGTGGATATTATTTTACACGTTTTATTTTGTATGGAAGATTGTCGTGTGGACGAAAAATCGCATCGGCTCTTCAAACACAAATGTAAATTTCAATGCGGAAAAAAACTTTTACGTCGCTATCACGTGTATTATGGTAAACGTGATCACTGGGCTGTGTTGGATGCTGTTTGCCGCGTTT---CAAATCTACGTGTTCAAAAATGGTCATCTACCGACGCTAGATGTTTTATATCGTCACTACGATTTGGAATCGGTGTGCTGGAACTCTATCGTGTATTTGGAAATTGACTACGAAAATGCCGAAATCTTGAGC------CAAAACTGTGTGTATGAGAAC---CTTTACAAAAAATGCATCATGTGCCGAGCGATTGTAAGGGATCACGAGCCGACCGTGTTTAATCAAAACTATTCCGTAATCATAATGGGCGTGCTTACGATACTAGCTGTGCAATGCTGGAATTTGTACGTGCAATTAAAAGAGATGCGTCGC
TRN  10010101100011000
//