EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06737 - Transglycosylas)
FAM  PF06737
PID  Transglycosylas
DES  Transglycosylase-like domain
IPR  IPR010618
ANO  22
ALN  81
AID  0.45939
APH  (((((((((O86308_MICLU/41-115:0.55102,Q8CK41_STRCO/41-118:0.07072):0.14223,(Q9L157_STRCO/45-121:0.45286,O05594_MYCTU/279-356:0.26084):0.06756):0.09790,(Q9F2Q2_STRCO/41-118:0.16544,(((Q8FQZ6_COREF/307-384:0.09917,Q8NRY2_CORGL/274-351:0.11572):0.24038,Q8FR70_COREF/38-115:0.17961):0.08833,O33049_MYCLE/37-114:0.16088):0.07999):0.05598):0.05643,Q9F2Q1_STRCO/40-117:0.30630):0.07539,Q8VJI4_MYCTU/111-185:0.22690):0.11098,((O07747_MYCTU/67-141:0.06346,Q9CBF8_MYCLE/43-117:0.19375):0.20833,P71755_MYCTU/48-122:0.30025):0.05364):0.24490,Q8CJX5_STRCO/378-453:0.78587):0.29704,((Q88TF1_LACPL/157-220:0.37148,((ISAA_STAEP/172-235:0.09453,Q99XI4_STRPY/141-204:0.26458):0.05459,ISAA_STAAN/170-233:0.10890):0.22814):0.14709,Q9CF19_LACLA/136-199:0.63414):0.26433):0.62561,O54493_STACA/154-232:0.29920,Q99SG2_STAAM/153-231:0.00000);
ATP  (((((((((O86308_MICLU/41-115,Q8CK41_STRCO/41-118),(Q9L157_STRCO/45-121,O05594_MYCTU/279-356)),(Q9F2Q2_STRCO/41-118,(((Q8FQZ6_COREF/307-384,Q8NRY2_CORGL/274-351),Q8FR70_COREF/38-115),O33049_MYCLE/37-114))),Q9F2Q1_STRCO/40-117),Q8VJI4_MYCTU/111-185),((O07747_MYCTU/67-141,Q9CBF8_MYCLE/43-117),P71755_MYCTU/48-122)),Q8CJX5_STRCO/378-453),((Q88TF1_LACPL/157-220,((ISAA_STAEP/172-235,Q99XI4_STRPY/141-204),ISAA_STAAN/170-233)),Q9CF19_LACLA/136-199)),O54493_STACA/154-232,Q99SG2_STAAM/153-231);
ATL  8.85739
DNO  22
DLN  243
DID  0.515739
DPH  (((O33049_MYCLE/37-114:0.22858,Q8FR70_COREF/38-115:0.14911):0.07836,(((Q8FQZ6_COREF/307-384:0.06516,Q8NRY2_CORGL/274-351:0.23257):0.16657,((O07747_MYCTU/67-141:0.11351,Q9CBF8_MYCLE/43-117:0.22518):0.15418,(P71755_MYCTU/48-122:0.10484,(Q88TF1_LACPL/157-220:0.13996,(((ISAA_STAEP/172-235:0.10552,Q99XI4_STRPY/141-204:0.27943):0.05169,ISAA_STAAN/170-233:0.09875):0.11507,(Q9CF19_LACLA/136-199:0.33848,(O54493_STACA/154-232:0.13260,Q99SG2_STAAM/153-231:0.10549):0.39622):0.12784):0.22406):0.49419):0.15421):0.09349):0.03025,Q8VJI4_MYCTU/111-185:0.22359):0.03617):0.04236,(Q9L157_STRCO/45-121:0.29156,O05594_MYCTU/279-356:0.21539):0.04235,(((O86308_MICLU/41-115:0.13249,Q8CJX5_STRCO/378-453:0.45911):0.10649,Q8CK41_STRCO/41-118:0.09085):0.10060,(Q9F2Q2_STRCO/41-118:0.15043,Q9F2Q1_STRCO/40-117:0.21268):0.06075):0.04973);
DTP  (((O33049_MYCLE/37-114,Q8FR70_COREF/38-115),(((Q8FQZ6_COREF/307-384,Q8NRY2_CORGL/274-351),((O07747_MYCTU/67-141,Q9CBF8_MYCLE/43-117),(P71755_MYCTU/48-122,(Q88TF1_LACPL/157-220,(((ISAA_STAEP/172-235,Q99XI4_STRPY/141-204),ISAA_STAAN/170-233),(Q9CF19_LACLA/136-199,(O54493_STACA/154-232,Q99SG2_STAAM/153-231))))))),Q8VJI4_MYCTU/111-185)),(Q9L157_STRCO/45-121,O05594_MYCTU/279-356),(((O86308_MICLU/41-115,Q8CJX5_STRCO/378-453),Q8CK41_STRCO/41-118),(Q9F2Q2_STRCO/41-118,Q9F2Q1_STRCO/40-117)));
DTL  6.61986
RID  0.45939
RPH  (((((((((O86308_MICLU/41-115:0.55102,Q8CK41_STRCO/41-118:0.07072):0.14223,(Q9L157_STRCO/45-121:0.45286,O05594_MYCTU/279-356:0.26084):0.06756):0.09790,(Q9F2Q2_STRCO/41-118:0.16544,(((Q8FQZ6_COREF/307-384:0.09917,Q8NRY2_CORGL/274-351:0.11572):0.24038,Q8FR70_COREF/38-115:0.17961):0.08833,O33049_MYCLE/37-114:0.16088):0.07999):0.05598):0.05643,Q9F2Q1_STRCO/40-117:0.30630):0.07539,Q8VJI4_MYCTU/111-185:0.22690):0.11098,((O07747_MYCTU/67-141:0.06346,Q9CBF8_MYCLE/43-117:0.19375):0.20833,P71755_MYCTU/48-122:0.30025):0.05364):0.24490,Q8CJX5_STRCO/378-453:0.78587):0.29704,((Q88TF1_LACPL/157-220:0.37148,((ISAA_STAEP/172-235:0.09453,Q99XI4_STRPY/141-204:0.26458):0.05459,ISAA_STAAN/170-233:0.10890):0.22814):0.14709,Q9CF19_LACLA/136-199:0.63414):0.26433):0.62561,O54493_STACA/154-232:0.29920,Q99SG2_STAAM/153-231:0.00000);
RTP  (((((((((O86308_MICLU/41-115,Q8CK41_STRCO/41-118),(Q9L157_STRCO/45-121,O05594_MYCTU/279-356)),(Q9F2Q2_STRCO/41-118,(((Q8FQZ6_COREF/307-384,Q8NRY2_CORGL/274-351),Q8FR70_COREF/38-115),O33049_MYCLE/37-114))),Q9F2Q1_STRCO/40-117),Q8VJI4_MYCTU/111-185),((O07747_MYCTU/67-141,Q9CBF8_MYCLE/43-117),P71755_MYCTU/48-122)),Q8CJX5_STRCO/378-453),((Q88TF1_LACPL/157-220,((ISAA_STAEP/172-235,Q99XI4_STRPY/141-204),ISAA_STAAN/170-233)),Q9CF19_LACLA/136-199)),O54493_STACA/154-232,Q99SG2_STAAM/153-231);
RTL  8.85739
LNK  ISAA_STAAN/170-233:P99160:AP003137
LNK  ISAA_STAEP/172-235:Q8CMZ9:AE016751
LNK  O05594_MYCTU/279-356:O05594:BX842575
LNK  O07747_MYCTU/67-141:O07747:BX842578
LNK  O33049_MYCLE/37-114:O33049:Z99494
LNK  O54493_STACA/154-232:O54493:AF109218
LNK  O86308_MICLU/41-115:O86308:Z96935
LNK  P71755_MYCTU/48-122:P71755:BX842579
LNK  Q88TF1_LACPL/157-220:Q88TF1:AL935260
LNK  Q8CJX5_STRCO/378-453:Q8CJX5:AL939115
LNK  Q8CK41_STRCO/41-118:Q8CK41:AL939107
LNK  Q8FQZ6_COREF/307-384:Q8FQZ6:BA000035
LNK  Q8FR70_COREF/38-115:Q8FR70:BA000035
LNK  Q8NRY2_CORGL/274-351:Q8NRY2:BA000036
LNK  Q8VJI4_MYCTU/111-185:Q8VJI4:AE000516
LNK  Q99SG2_STAAM/153-231:Q99SG2:BA000017
LNK  Q99XI4_STRPY/141-204:Q99XI4:AE006636
LNK  Q9CBF8_MYCLE/43-117:Q9CBF8:AL583924
LNK  Q9CF19_LACLA/136-199:Q9CF19:AE006396
LNK  Q9F2Q1_STRCO/40-117:Q9F2Q1:AL939115
LNK  Q9F2Q2_STRCO/41-118:Q9F2Q2:AL939115
LNK  Q9L157_STRCO/45-121:Q9L157:AL939131
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q99SG2_STAAM/153-231
ASQ  VNVNAHLKQIAQRESGGNIHAVNPTSGAAGKY-QFLQSTWDSVAPAKYKGvSPANAPESVQDAAAVKLYNTGGAGHWVTA-
DSQ  GTAAATGTGAATGCTCATCTAAAACAAATTGCTCAACGTGAATCAGGTGGCAATATTCATGCTGTAAATCCAACATCAGGTGCAGCTGGTAAGTAT---CAATTCTTACAATCAACTTGGGATTCAGTAGCACCTGCTAAATATAAAGGTgtaTCACCAGCAAATGCTCCTGAAAGTGTTCAAGATGCCGCAGCAGTAAAATTATATAACACTGGTGGCGCTGGACATTGGGTTACTGCA---
TRN  11011101111011000
NAM  O54493_STACA/154-232
ASQ  VQVNDHLKAIAQRESGGDIHAINSSSGAAGKY-QFLQTTWDSVAPAEYQGkPASEAPEAVQDAAAQKLYDTAGPSQWVTA-
DSQ  GTACAAGTTAACGATCACTTAAAAGCAATTGCTCAACGTGAATCAGGTGGCGACATCCATGCGATTAACTCATCATCAGGTGCAGCAGGTAAATAC---CAATTCTTACAAACTACTTGGGATTCAGTAGCTCCTGCAGAATATCAAGGTaaaCCAGCATCAGAAGCTCCTGAAGCAGTACAAGATGCAGCAGCTCAAAAATTATATGACACAGCTGGCCCAAGCCAATGGGTAACTGCA---
TRN  11111101111011000
NAM  Q9CF19_LACLA/136-199
ASQ  GYSASEWAYIITHESNGGIDSVNSSSGAYGAF-QL-------LGHGEYA-.---GMTLAEQIAMASKLPA--G--SWVVYN
DSQ  GGCTATTCTGCTAGCGAATGGGCTTATATCATTACTCACGAATCAAATGGTGGGATTGATAGTGTGAATTCAAGTTCAGGTGCTTATGGTGCTTTC---CAATTG---------------------CTAGGTCATGGCGAATATGCT---...---------GGAATGACTTTGGCAGAACAAATTGCGATGGCAAGTAAACTTCCTGCT------GGT------AGCTGGGTTGTTTATAAC
TRN  11011101111011001
NAM  Q99XI4_STRPY/141-204
ASQ  GVPQSTWEHIIARESNGNP-NAANASGASGLF-QTMPG-W---GST----.----ATVEDQVNAALKAYSAQGLSAWGY--
DSQ  GGTGTTCCACAATCAACTTGGGAACATATAATTGCGCGTGAATCTAATGGAAATCCT---AACGCAGCTAATGCTTCTGGGGCATCAGGGTTGTTC---CAGACAATGCCAGGT---TGG---------GGTTCTACA------------...------------GCAACGGTTGAAGATCAAGTCAATGCAGCCTTGAAAGCCTATAGTGCACAAGGTTTATCAGCTTGGGGTTAC------
TRN  10010101110011000
NAM  ISAA_STAAN/170-233
ASQ  GVSASTWAAIIARESNGQVNAYNP-SGASG-LFQTMPG-W---GPTN---.-----TVDQQINAAVKAYKAQGLGAWGF--
DSQ  GGTGTTTCAGCTTCTACATGGGCTGCAATCATCGCTCGTGAATCAAATGGTCAAGTAAATGCTTACAACCCA---TCAGGTGCTTCAGGT---TTATTCCAAACTATGCCAGGT---TGG---------GGTCCGACAAAC---------...---------------ACTGTTGACCAACAAATCAACGCAGCTGTTAAAGCATACAAAGCACAAGGTTTAGGTGCTTGGGGATTC------
TRN  11111101111011000
NAM  ISAA_STAEP/172-235
ASQ  GVSASTWEHIIARESNGQLHARN-ASGAAG-LFQTMPG-WGSTG------.-----SVNDQINAAYKAYKAQGLSAWGM--
DSQ  GGTGTATCTGCTTCAACATGGGAACACATCATTGCTAGAGAATCAAATGGTCAATTACATGCACGTAAT---GCTTCAGGTGCTGCTGGA---TTATTCCAAACTATGCCAGGT---TGGGGTTCAACTGGT------------------...---------------TCAGTAAATGATCAAATCAATGCCGCTTATAAAGCATATAAAGCACAAGGTTTATCTGCTTGGGGTATG------
TRN  10110101110011000
NAM  Q88TF1_LACPL/157-220
ASQ  GVDAGTWNHIINRESNWQPHVVNGASGAYG-LFQNIHIS----GG-----.-----SVQQQIDAAVNLYHAQGMQAWALY-
DSQ  GGTGTTGACGCCGGAACTTGGAATCACATCATCAATCGTGAATCTAACTGGCAGCCACACGTCGTTAACGGCGCAAGCGGTGCATACGGT---TTATTCCAAAACATCCATATTAGT------------GGTGGT---------------...---------------TCCGTTCAACAACAAATCGACGCCGCAGTTAACTTGTACCACGCACAAGGCATGCAAGCCTGGGCCCTCTAT---
TRN  11011111111111110
NAM  Q8CJX5_STRCO/378-453
ASQ  GADHLNWQGLAACESGGRA-DAVDPSGTYGGLYQFDSATWHGLGGEG---.RPEDASAAEQTYRAQKLYVRSGADAWPHCG
DSQ  GGCGCCGACCACCTGAACTGGCAGGGCCTGGCCGCCTGCGAGTCCGGCGGCCGCGCG---GACGCCGTCGACCCGTCCGGCACCTACGGCGGGCTCTACCAGTTCGACTCCGCCACCTGGCACGGCCTCGGCGGCGAGGGG---------...CGCCCCGAGGACGCGTCCGCCGCGGAGCAGACGTACCGGGCGCAGAAGCTCTACGTGCGCAGCGGCGCCGACGCCTGGCCGCACTGCGGC
TRN  11011111101111111
NAM  Q9F2Q1_STRCO/40-117
ASQ  AADSTNWDQVAECETGGAW-SQNSGNGYYGGL-QLSQDAWEQYGGLDYAP.SADQASRSQQIRIAEKIHASQGIAAWPTCG
DSQ  GCGGCCGACTCCACGAACTGGGACCAGGTCGCCGAGTGCGAGACCGGCGGCGCCTGG---AGCCAGAACAGCGGCAACGGGTACTACGGCGGCCTG---CAGCTGTCCCAGGATGCCTGGGAGCAGTACGGCGGTCTGGACTACGCTCCC...AGCGCCGACCAGGCCAGTCGCTCCCAGCAGATAAGAATCGCCGAGAAGATACACGCGTCGCAGGGCATCGCTGCCTGGCCGACCTGCGGT
TRN  10010101100011011
NAM  P71755_MYCTU/48-122
ASQ  KADDIDWDAIAQCESGGNW-AANTGNGLYGGL-QISQATWDSNGGVG---.SPAAASPQQQIEVADNIMKTQGPGAWPKCS
DSQ  AAAGCCGACGACATCGATTGGGACGCCATCGCGCAATGCGAATCCGGCGGCAATTGG---GCGGCCAACACCGGTAACGGGTTATACGGTGGTCTG---CAGATCAGCCAGGCGACGTGGGATTCCAACGGTGGTGTCGGG---------...TCGCCGGCGGCCGCGAGTCCCCAGCAACAGATCGAGGTCGCAGACAACATTATGAAAACCCAAGGCCCGGGTGCGTGGCCGAAATGTAGT
TRN  11011101101011010
NAM  Q8VJI4_MYCTU/111-185
ASQ  VAYSVNWDAIAQCESGGNW-SINTGNGYYGGL-QFTAGTWRANGG---SG.SAANASREEQIRVAENVLRSQGIRAWPVCG
DSQ  GTGGCCTACAGCGTGAACTGGGACGCGATCGCGCAGTGCGAGTCCGGTGGAAACTGG---TCGATCAACACCGGTAACGGTTACTACGGCGGCCTG---CAGTTCACCGCCGGCACCTGGCGTGCCAACGGTGGC---------TCGGGG...TCCGCGGCCAACGCGAGCCGGGAGGAGCAGATCCGGGTGGCTGAGAACGTGCTGCGTTCGCAGGGTATCCGCGCCTGGCCGGTCTGCGGC
TRN  11011111101111111
NAM  Q9CBF8_MYCLE/43-117
ASQ  VPREPNWDAVAQCESGRNW-RANTGNGFYGGL-QFKPTIWARYGGVG---.NPAGASREQQITVANRVLADQGLDAWPKCG
DSQ  GTTCCTAGGGAACCTAACTGGGATGCGGTCGCGCAGTGCGAGTCCGGCAGAAACTGG---CGAGCTAACACCGGAAACGGCTTTTACGGTGGACTG---CAATTTAAGCCAACCATCTGGGCCCGATACGGCGGTGTCGGC---------...AATCCTGCCGGCGCGTCCAGAGAGCAACAAATCACGGTGGCCAACCGAGTTTTAGCTGATCAAGGGCTAGACGCATGGCCGAAATGCGGT
TRN  10010101100011010
NAM  O07747_MYCTU/67-141
ASQ  AGPSPNWDAVAQCESGGNW-AANTGNGKYGGL-QFKPATWAAFGGVG---.NPAAASREQQIAVANRVLAEQGLDAWPTCG
DSQ  GCCGGTCCCAGCCCGAACTGGGACGCCGTCGCGCAGTGCGAATCCGGGGGCAACTGG---GCGGCCAACACCGGAAACGGCAAATACGGCGGACTG---CAGTTCAAGCCGGCCACCTGGGCCGCATTCGGCGGTGTCGGC---------...AACCCAGCAGCTGCCTCTCGGGAACAACAAATCGCAGTTGCCAATCGGGTTCTCGCCGAACAGGGATTGGACGCGTGGCCGACGTGCGGC
TRN  11011101101011011
NAM  Q8NRY2_CORGL/274-351
ASQ  VAANSVWDQLAQCESGGNW-AINTGNGFSGGL-QFHPQTWLAYGGGAFSG.DASGASREQQISIAEKVQAAQGWGAWPACT
DSQ  GTCGCTGCAAACTCCGTGTGGGATCAGCTGGCACAGTGTGAATCCGGCGGAAACTGG---GCAATCAACACAGGTAATGGCTTCTCCGGCGGCCTA---CAGTTCCACCCACAGACCTGGCTCGCATACGGTGGTGGAGCTTTCTCCGGT...GACGCTTCCGGTGCAAGCCGTGAACAGCAAATCTCCATCGCAGAAAAGGTTCAGGCTGCACAAGGTTGGGGAGCATGGCCTGCTTGCACC
TRN  11011111101111111
NAM  Q8FQZ6_COREF/307-384
ASQ  VAGGSVWDALAQCESNGNW-SINTGNGFSGGL-QFHPQTWQAYGGGQYAP.TAAGASREQQIAIAQKVQAAQGWGAWPACT
DSQ  GTGGCCGGTGGTTCCGTGTGGGATGCGCTGGCACAGTGTGAATCCAACGGCAACTGG---TCTATCAACACCGGCAATGGTTTCTCCGGTGGTCTG---CAGTTCCACCCCCAGACCTGGCAGGCCTACGGTGGCGGCCAGTATGCACCC...ACCGCAGCCGGTGCCTCCCGCGAGCAGCAGATCGCCATCGCCCAGAAGGTCCAGGCGGCCCAGGGTTGGGGAGCCTGGCCGGCCTGCACC
TRN  11011111101111111
NAM  Q9F2Q2_STRCO/41-118
ASQ  AATASEWDAVAQCESGGNW-SINTGNGYYGGL-QFSASTWAAYGGTQYAS.TADQASKSQQIQIAEKVLAGQGKGAWPVCG
DSQ  GCCGCCACCGCGTCCGAGTGGGACGCCGTCGCCCAGTGCGAGTCCGGCGGCAACTGG---TCCATCAACACCGGCAACGGTTACTACGGCGGTCTG---CAGTTCTCCGCCTCCACCTGGGCCGCCTACGGCGGTACGCAGTACGCCTCC...ACCGCCGACCAGGCGAGCAAGTCCCAGCAGATCCAGATCGCCGAGAAGGTGCTCGCGGGCCAGGGCAAGGGTGCCTGGCCGGTCTGCGGC
TRN  11011111101111111
NAM  Q8FR70_COREF/38-115
ASQ  AAPDSDWDRLANCESGGNW-AINTGNGYHGGL-QFSPSTWRAYGGDEFAP.FAYQATREQQIAVAERTLAGQGWGAWPACS
DSQ  GCAGCCCCCGACTCTGACTGGGACCGTCTCGCCAACTGCGAGTCCGGTGGAAACTGG---GCCATCAACACCGGCAACGGCTACCACGGTGGCCTG---CAGTTCTCCCCGAGCACCTGGCGCGCCTACGGTGGCGACGAGTTCGCACCG...TTTGCCTACCAGGCCACCCGCGAGCAGCAGATCGCCGTCGCCGAGCGCACCCTCGCCGGTCAGGGCTGGGGCGCATGGCCCGCCTGCTCA
TRN  11011111101111101
NAM  O33049_MYCLE/37-114
ASQ  PATDSEWDQVARCESGGNW-SINTGNGYLGGL-QFSQGTWASHGGGEYAP.SAQLATREQQIAVAERVLATQGSGAWPACG
DSQ  CCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAGTCCGGTGGGAACTGG---TCAATCAACACCGGCAACGGATACCTCGGTGGCCTG---CAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCACCA...TCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGCGTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGT
TRN  10010101100011001
NAM  Q8CK41_STRCO/41-118
ASQ  AADAATWDKVAACESTDDW-DINTGNGYYGGL-QFTQSTWEAFGGTRYAP.RADLATREQQIAGAEKVLDTQGPGAWPVCS
DSQ  GCGGCCGACGCGGCGACCTGGGACAAGGTCGCCGCCTGCGAGTCCACCGACGACTGG---GACATCAACACCGGCAACGGCTACTACGGCGGGCTG---CAGTTCACGCAGTCCACCTGGGAGGCCTTCGGCGGCACGCGGTACGCCCCG...CGGGCCGACCTGGCCACCAGGGAGCAGCAGATCGCCGGCGCCGAGAAGGTGCTGGACACGCAGGGGCCCGGCGCCTGGCCGGTGTGCTCG
TRN  10010101100011011
NAM  O05594_MYCTU/279-356
ASQ  VIDGSIWDAIAGCEAGGNW-AINTGNGYYGGV-QFDQGTWEANGGLRYAP.RADLATREEQIAVAEVTRLRQGWGAWPVCA
DSQ  GTGATCGACGGAAGCATCTGGGACGCGATCGCCGGCTGTGAGGCCGGTGGCAACTGG---GCGATCAACACCGGCAACGGGTATTACGGTGGTGTG---CAGTTTGACCAGGGCACCTGGGAGGCCAACGGCGGGCTGCGGTATGCACCC...CGCGCTGACCTCGCCACCCGCGAAGAGCAGATCGCCGTTGCCGAGGTGACCCGACTGCGTCAAGGTTGGGGCGCCTGGCCGGTATGTGCT
TRN  11011111101111111
NAM  Q9L157_STRCO/45-121
ASQ  APLRTDWDAIAACESSGNW-QANTGNGYYGGL-QFARSSWIAAGGLKYAP.RADLATRGEQIAVAERLARLQGMSAWGCA-
DSQ  GCGCCCCTGCGCACCGACTGGGACGCCATCGCCGCGTGCGAGTCCAGCGGCAACTGG---CAGGCGAACACCGGCAACGGCTACTACGGCGGCCTG---CAGTTCGCACGGTCCAGCTGGATCGCCGCCGGCGGCCTCAAGTACGCCCCG...CGCGCGGACCTCGCCACCCGCGGCGAGCAGATCGCCGTGGCGGAACGCCTCGCCCGTCTGCAGGGGATGTCCGCCTGGGGCTGCGCC---
TRN  11011111101111111
NAM  O86308_MICLU/41-115
ASQ  AATVDTWDRLAECESNGTW-DINTGNGFYGGV-QFTLSSWQAVGGEGY--.-PHQASKAEQIKRAEILQDLQGWGAWPLCS
DSQ  GCCGCCACCGTGGACACCTGGGACCGCCTCGCCGAGTGCGAGTCCAACGGCACCTGG---GACATCAACACCGGCAACGGCTTCTACGGCGGCGTG---CAGTTCACCCTGTCCTCCTGGCAGGCCGTCGGCGGCGAAGGCTAC------...---CCGCACCAGGCCTCGAAGGCCGAGCAGATCAAGCGCGCCGAGATCCTCCAGGACCTGCAGGGCTGGGGCGCGTGGCCGCTGTGCTCG
TRN  11011111101111111
//