EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06732 - Pescadillo_N)
FAM  PF06732
PID  Pescadillo_N
DES  Pescadillo N-terminus
IPR  IPR010613
ANO  9
ALN  298
AID  0.442741
APH  ((((Q9VL96_DROME/4-287:0.44077,Q8IIS5_PLAF7/7-292:0.97306):0.09331,Q95Y89_CAEEL/6-287:0.44446):0.12584,(((O97209_LEIMA/11-301:0.99371,PESC_YEAST/4-285:0.31811):0.16226,PESC_SCHPO/5-286:0.20085):0.12830,Q9LYK7_ARATH/8-286:0.58105):0.10542):0.21174,PESC_HUMAN/6-287:0.12602,PESC_BRARE/6-287:0.14710);
ATP  ((((Q9VL96_DROME/4-287,Q8IIS5_PLAF7/7-292),Q95Y89_CAEEL/6-287),(((O97209_LEIMA/11-301,PESC_YEAST/4-285),PESC_SCHPO/5-286),Q9LYK7_ARATH/8-286)),PESC_HUMAN/6-287,PESC_BRARE/6-287);
ATL  5.05198
DNO  9
DLN  894
DID  0.487754
DPH  ((((Q95Y89_CAEEL/6-287:0.35709,O97209_LEIMA/11-301:0.62551):0.04913,(((Q8IIS5_PLAF7/7-292:0.67383,PESC_YEAST/4-285:0.27102):0.10862,PESC_SCHPO/5-286:0.24539):0.11919,Q9LYK7_ARATH/8-286:0.46146):0.14472):0.08477,Q9VL96_DROME/4-287:0.43495):0.12361,PESC_HUMAN/6-287:0.15263,PESC_BRARE/6-287:0.24931);
DTP  ((((Q95Y89_CAEEL/6-287,O97209_LEIMA/11-301),(((Q8IIS5_PLAF7/7-292,PESC_YEAST/4-285),PESC_SCHPO/5-286),Q9LYK7_ARATH/8-286)),Q9VL96_DROME/4-287),PESC_HUMAN/6-287,PESC_BRARE/6-287);
DTL  4.10123
RID  0.442741
RPH  ((((Q9VL96_DROME/4-287:0.44077,Q8IIS5_PLAF7/7-292:0.97306):0.09331,Q95Y89_CAEEL/6-287:0.44446):0.12584,(((O97209_LEIMA/11-301:0.99371,PESC_YEAST/4-285:0.31811):0.16226,PESC_SCHPO/5-286:0.20085):0.12830,Q9LYK7_ARATH/8-286:0.58105):0.10542):0.21174,PESC_HUMAN/6-287:0.12602,PESC_BRARE/6-287:0.14710);
RTP  ((((Q9VL96_DROME/4-287,Q8IIS5_PLAF7/7-292),Q95Y89_CAEEL/6-287),(((O97209_LEIMA/11-301,PESC_YEAST/4-285),PESC_SCHPO/5-286),Q9LYK7_ARATH/8-286)),PESC_HUMAN/6-287,PESC_BRARE/6-287);
RTL  5.05198
LNK  O97209_LEIMA/11-301:O97209:AL139794
LNK  PESC_BRARE/6-287:P79741:U77627
LNK  PESC_HUMAN/6-287:O00541:U78310
LNK  PESC_SCHPO/5-286:O60164:AL022599
LNK  PESC_YEAST/4-285:P53261:Z72888
LNK  Q8IIS5_PLAF7/7-292:Q8IIS5:AE014837
LNK  Q95Y89_CAEEL/6-287:Q95Y89:AC006679
LNK  Q9LYK7_ARATH/8-286:Q9LYK7:AL163792
LNK  Q9VL96_DROME/4-287:Q9VL96:AE003626
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9VL96_DROME/4-287
ASQ  PKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYPREPKH-RRRAQKGSSEIKVLYHTKDIRFLLHESIVWTLRDYKIFAKKSNRDR-AIKDFRNLKRRLAL--FPEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSLHL----------IPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQAEIKGQKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTIMLGFTNFRLFHGLNLAYPPQFPSSVLQDSEESLKDEASFVSDRIAALNFELLRTDKVQ
DSQ  CCCAAGAAGTACGAGTCCGGTGAGGCTACGCAGTACATTAGTCGCCGGGCTGCGCTCAGGAAACTCCAGCTCTCGCTGAACGATTTCCGGAGGCTGTGCATCCTGAAGGGCGTCTATCCCCGGGAACCGAAACAT---AGGCGTAGAGCTCAAAAGGGATCTTCGGAGATCAAGGTGCTTTATCACACCAAGGACATTCGCTTTCTGCTGCATGAGTCGATTGTGTGGACGCTGCGTGACTACAAGATCTTTGCCAAGAAGAGCAATCGCGATCGT---GCCATCAAGGATTTCCGCAACCTGAAGCGTCGATTGGCCCTG------TTTCCCGAAATCAAACTCGATCACATTGTCAAAGAGCGCTATCCTACCTTCATCGATGCCCTCAAGGATCTGGATGATTGTCTGACGCTGCTCTTTCTGTTCAGCACCTTTCCCTCGCTGCACTTG------------------------------ATTCCCAGGGAGCAGTCGAATCTGTGCCGCCGTCTGACTATTGAGTTCCTACACTACGTGATCGCGTCAAAGTCGCTGCGCAAGGTGTTCATCTCCATCAAAGGCTACTACTTCCAAGCGGAGATCAAGGGCCAGAAGGTCACTTGGATTGTGCCGCATTACTATCCGTTCAAGCCACAGTCACGCCAGGAGGTGGACTTCAAGGTGATGTCCATCTTTGTGGAGTTCTACACCATTATGCTGGGCTTCACCAACTTCCGGCTATTCCATGGCCTGAATCTGGCCTATCCACCACAATTCCCAAGCAGCGTGCTTCAGGACAGCGAAGAGTCCCTGAAGGATGAGGCCAGCTTCGTATCTGACCGCATTGCAGCCTTGAACTTCGAGCTACTGCGCACGGACAAGGTGCAG
TRN  10010101100011001
NAM  Q95Y89_CAEEL/6-287
ASQ  KQKYTAGAAVAYMSRKQALKKLQLTLKDFRRLCIIKGIYPHEPAH-KKQANKGSTANKVFYYRKDINFLAHEPIINKFRDYKVFLRKLNHLK-AKKEEDKLKKLYEN--KPVYSLDTIVKERFPTFGSALRDMDDALSLCFTFAMLPHTRV----------LKEGMIDSCRKLTAEFMHYVIESQSLRNTFISIKGIYYQAEVHGEKITWVVPH--ERGLPHVTDVDFTVLVTFVEFYIAMLGFVNFKLYQDIGLFYPPQIGQVVKTDEMETEEYKEKVYSLAKPLAKRKDVEQAEDD
DSQ  AAACAAAAGTACACAGCCGGAGCTGCCGTGGCATATATGTCACGGAAACAAGCATTGAAGAAGCTTCAACTTACACTGAAGGACTTCCGCCGACTTTGTATTATTAAGGGAATCTACCCACACGAACCGGCCCAC---AAGAAGCAAGCAAACAAGGGTTCAACTGCAAATAAGGTGTTCTATTATCGCAAAGACATCAATTTTCTCGCCCACGAACCCATCATCAATAAGTTCAGAGATTATAAGGTGTTCCTGCGTAAATTGAATCACTTGAAA---GCAAAGAAGGAAGAGGATAAACTCAAGAAGTTGTACGAAAAC------AAGCCAGTCTATAGTCTGGACACTATCGTCAAGGAACGCTTCCCAACATTTGGATCAGCTCTCAGAGATATGGATGACGCCTTGTCCCTTTGCTTCACATTCGCTATGCTTCCACATACTCGTGTT------------------------------CTCAAAGAAGGAATGATTGACAGTTGCCGAAAACTCACTGCGGAGTTCATGCACTATGTGATTGAATCGCAATCTCTTCGCAATACCTTCATCTCGATCAAGGGAATTTACTATCAAGCGGAGGTACATGGAGAGAAAATCACTTGGGTTGTTCCACAC------GAGCGTGGTCTTCCACATGTCACCGATGTTGATTTCACAGTCCTCGTGACTTTCGTCGAGTTTTACATTGCCATGTTGGGGTTTGTCAATTTCAAGCTCTATCAAGACATCGGACTCTTCTACCCACCACAGATCGGGCAAGTCGTGAAAACTGATGAAATGGAGACTGAAGAATACAAAGAAAAGGTGTACAGTTTGGCGAAACCATTGGCTAAGAGAAAGGATGTTGAGCAGGCTGAAGACGAT
TRN  10010101100011001
NAM  PESC_BRARE/6-287
ASQ  KKKYESGSATNYITRNKARKKLSLSLADFRRLCILKGIYPHEPKH-KKKVNKGSTAARTYYLLKDIRFLLHEPIVGKFREYKIFVRKLRKAY-GKAEWSAVERLKEN--KPGYKLDHIIKERYPTFIDALRDVDDALSMCFLFSTFARTGK----------CHVQTIQLCRRLSVEWMNYIISSRSLRKVFLSIKGIYYQAEVLGQTITWIVPY--QFAHNHPTDVDYRVMATFTELYTTLLGFVNFRLYQTLNLVYPPKLDGQGEISLKAEFEEDYALESESYTEKLSALSASLARM
DSQ  AAGAAGAAGTATGAGAGTGGGTCAGCCACTAACTACATCACCAGGAATAAAGCTCGTAAGAAGCTGAGTCTGAGTCTGGCTGATTTCAGGCGGTTATGCATATTAAAAGGAATTTATCCTCATGAGCCCAAACAC---AAAAAGAAGGTCAACAAGGGCTCGACGGCTGCTAGAACTTACTATCTGCTGAAAGACATCCGCTTCCTGCTGCATGAACCCATCGTTGGCAAATTCAGAGAGTATAAGATCTTTGTCCGGAAGCTGCGGAAAGCGTAT---GGGAAGGCTGAGTGGAGCGCAGTGGAGAGACTGAAAGAAAAC------AAGCCTGGCTACAAACTGGACCACATCATCAAGGAGAGGTATCCCACGTTCATTGATGCTCTCCGAGATGTAGACGATGCCCTTTCTATGTGTTTTCTGTTCTCTACATTCGCTCGTACTGGAAAA------------------------------TGCCACGTCCAGACAATTCAGCTGTGTCGGAGACTCAGTGTTGAGTGGATGAACTACATCATCTCCTCACGCTCCCTAAGAAAGGTTTTTCTTTCCATTAAGGGTATTTACTATCAGGCAGAGGTTTTGGGACAGACCATCACATGGATCGTACCATAT------CAGTTTGCCCATAATCATCCTACAGATGTGGACTACAGAGTTATGGCCACATTCACAGAGCTCTACACAACACTGCTCGGCTTCGTTAACTTCCGCCTTTATCAGACTCTCAACCTTGTCTACCCGCCCAAGCTCGATGGACAAGGAGAGATCAGTCTCAAAGCAGAGTTTGAAGAAGATTACGCCCTGGAATCTGAAAGCTACACTGAGAAACTGTCAGCATTGAGTGCCAGTCTGGCTCGTATG
TRN  10010101100011000
NAM  PESC_HUMAN/6-287
ASQ  KKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKH-KKKVNKGSTAARTFYLIKDIRFLLHEPIVNKFREYKVFVRKLRKAY-GKSEWNTVERLKDN--KPNYKLDHIIKERYPTFIDALRDLDDALSMCFLFSTFPRTGK----------CHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAEVLGQPIVWITPY--AFSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVV
DSQ  AAGAAGAAGTATGAACGAGGCTCGGCCACCAACTACATCACCCGGAACAAAGCCCGGAAGAAGCTCCAGCTGAGCTTGGCTGACTTTAGGCGGCTGTGCATTCTGAAGGGCATTTATCCCCATGAACCCAAACAC---AAGAAGAAGGTTAACAAGGGTTCTACAGCAGCCCGAACGTTTTACCTTATCAAAGACATCAGGTTTCTCCTCCACGAACCCATTGTCAACAAGTTCCGTGAATACAAGGTGTTCGTCCGGAAGCTCCGGAAGGCTTAT---GGGAAGAGCGAGTGGAACACTGTAGAGCGTTTAAAGGACAAT------AAGCCCAACTACAAACTCGACCACATCATCAAGGAACGGTATCCCACGTTCATCGATGCCCTGCGGGACCTGGACGATGCCCTCTCCATGTGCTTCCTGTTTTCCACCTTCCCGCGGACTGGCAAG------------------------------TGCCACGTGCAGACCATTCAGCTGTGCCGCCGGCTCACTGTGGAGTTCATGCACTACATTATCGCTGCCCGTGCCCTGCGCAAGGTCTTCCTGTCCATCAAAGGCATTTACTACCAGGCCGAGGTACTGGGGCAGCCCATCGTGTGGATCACTCCCTAT------GCCTTCTCCCATGACCACCCGACAGACGTGGACTACAGGGTCATGGCCACCTTCACCGAGTTCTACACCACGCTGCTGGGCTTTGTCAACTTCCGCCTTTACCAGTTGCTCAACCTCCACTATCCCCCGAAGCTCGAGGGTCAGGCCCAAGCAGAGGCAAAGGCCGGTGAGGGCACCTACGCGTTGGACTCCGAGAGTTGTATGGAGAAACTGGCAGCCCTCAGTGCCAGCCTGGCCCGCGTGGTG
TRN  10010101100011010
NAM  PESC_SCHPO/5-286
ASQ  KQKGKAGAARIYITRNQALKKLQLTLADFRRICILKGVYPREPKN-KKKANKGSTAPVTFYYTKDIQYLLHEPIVQKFREYKVFARKLSKAL-GKGELETAKRLEAR--KPTYSLDHIIKERYPTFHDALKDIDDALSMLFLFSTMPVTDK----------IGAATVANCERLCAEFQHYVIRSNSLRKAFLSIKGIYYQAEIFGEQITWIVPY--KFAQSVPTDVDFRIMHTFLEFYQALMGFVNFKLYNTLGLRYPPKIDVAKSESAAGLAAYELEESSSLPAIVHGNNKNARKNI
DSQ  AAACAGAAAGGGAAAGCAGGTGCAGCTCGTATCTACATTACGAGAAATCAAGCGCTTAAGAAGCTTCAGCTCACTCTTGCTGATTTTCGTCGTATTTGTATTTTAAAGGGTGTTTATCCTCGTGAGCCAAAAAAT---AAGAAAAAAGCAAATAAAGGCTCCACTGCTCCAGTCACTTTCTATTATACTAAGGATATCCAGTATTTGTTACATGAGCCTATTGTACAGAAGTTTCGCGAGTACAAAGTGTTCGCTCGCAAGCTTAGCAAAGCATTG---GGAAAAGGGGAATTAGAAACTGCTAAACGTTTAGAGGCCAGA------AAACCCACTTATTCTTTGGATCATATCATTAAAGAGCGTTACCCAACCTTCCATGATGCCTTGAAAGATATTGATGATGCTCTTAGTATGCTGTTCTTATTTTCAACTATGCCTGTTACCGACAAG------------------------------ATTGGTGCCGCTACTGTCGCTAATTGTGAAAGATTATGTGCTGAATTTCAACACTATGTAATTCGGTCAAATTCCCTTCGTAAAGCTTTCCTCTCTATTAAAGGAATTTATTATCAGGCCGAGATTTTTGGTGAGCAAATCACCTGGATTGTTCCCTAC------AAATTTGCTCAATCTGTTCCTACCGATGTTGATTTTCGTATCATGCACACTTTTTTGGAATTTTATCAAGCACTTATGGGGTTTGTAAATTTCAAGTTATATAATACCTTGGGACTTCGTTATCCCCCTAAGATTGATGTTGCTAAAAGCGAATCTGCCGCTGGTTTAGCAGCTTATGAGTTAGAGGAGTCTTCTTCCTTACCCGCTATCGTCCATGGTAATAACAAAAATGCTCGTAAGAATATT
TRN  10010101100011000
NAM  PESC_YEAST/4-285
ASQ  KKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRN-KKKANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRAL-GRGEVSSAKRLEEN--RDSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPSTNQ----------VSSKIINDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWLVPF--KFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDLKKDKIISGLSSYILESRQEDSLLKLDPTEIEEDVK
DSQ  AAGAAGAAAAACACCAGAGGTAACGCAAGAAACTTTATTACCAGATCTCAAGCTGTGAGAAAATTACAGGTTTCTCTTGCTGATTTCAGAAGATTATGTATATTCAAAGGTATCTATCCTAGAGAGCCAAGAAAT---AAAAAGAAGGCAAACAAGGGCTCTACTGCACCAACTACTTTTTACTATGCTAAGGATATTCAATATCTAATGCATGAGCCCGTTTTGGCTAAATTTAGAGAACACAAGACTTTTGCTAGGAAACTAACAAGGGCTTTG---GGTAGGGGAGAAGTCTCTTCTGCTAAAAGGTTAGAGGAAAAC------AGAGATAGTTATACTTTAGACCATATTATCAAGGAGCGTTATCCAAGTTTCCCAGATGCTATAAGGGATATTGATGATGCTTTGAATATGTTATTTCTTTTCTCTAATTTGCCCTCTACCAACCAG------------------------------GTTTCCTCGAAAATTATCAATGATGCTCAGAAAATCTGTAATCAATGGTTAGCCTATGTTGCCAAGGAACGCTTGGTTCGTAAAGTGTTTGTATCCATTAAAGGTGTTTATTATCAAGCCAATATTAAGGGTGAAGAAGTTAGATGGTTAGTTCCATTC------AAGTTTCCAGAAAACATCCCCAGTGACGTTGATTTCAGAATTATGTTGACCTTCTTAGAATTCTACTCGACTCTATTGCATTTCGTCCTATATAAGTTATACACCGATAGTGGGTTGATTTATCCGCCAAAATTGGATCTTAAAAAGGATAAAATCATAAGTGGTTTGTCATCATATATTCTAGAATCCAGACAAGAAGACAGCCTACTAAAACTTGACCCAACTGAGATTGAGGAAGACGTAAAA
TRN  10010101110011000
NAM  Q9LYK7_ARATH/8-286
ASQ  TGKKKEGNAARYMTRSQALKHLQVNLNLFRRLCIVKGIFPREPKK-KIKGNH-----HTYYHVKDIAFLMHEPLLEKFREIKTYQKKVKKAK-AKKNEELARLLLTR--QPTYKLDRLIRERYPTFIDALRDLDDCLTMVHLFAVLPASDRE--------NLEVKRVHNCRRLTHEWQAYISRSHALRKVFVSVKGIYYQAEIEGQKITWLTPH--AIQQVFTNDVDFGVLLTFLEFYETLLAFINFKLYHSLNVKYPPILDSRLEALAADLYALSRYIDASSRGMAVEPKVDASFSS
DSQ  ACGGGGAAAAAGAAGGAAGGAAATGCGGCTAGGTATATGACCAGGTCGCAAGCTCTTAAACATCTTCAAGTTAACTTGAATCTATTCAGGAGACTATGTATTGTCAAAGGTATATTTCCCCGAGAACCAAAGAAG---AAGATTAAGGGAAACCAT---------------CACACTTACTACCATGTCAAGGACATTGCTTTCCTCATGCACGAGCCTCTTCTTGAGAAGTTTAGGGAAATCAAAACATACCAAAAGAAGGTCAAAAAAGCCAAG---GCCAAGAAAAACGAGGAGCTTGCACGCCTTCTGCTCACCCGC------CAACCTACTTACAAGCTTGATAGATTGATCCGTGAGAGGTATCCAACATTTATTGATGCACTGCGAGACTTGGATGACTGTCTCACTATGGTTCATCTTTTTGCGGTGTTACCTGCATCAGACAGGGAA------------------------AATCTTGAAGTTAAGCGAGTCCACAACTGTCGAAGATTGACCCATGAATGGCAAGCTTACATTTCACGTTCTCATGCGTTACGTAAAGTGTTTGTGTCTGTCAAGGGTATTTACTATCAGGCTGAAATAGAAGGTCAAAAGATCACTTGGTTGACCCCTCAT------GCAATCCAACAAGTTTTTACAAATGATGTTGACTTTGGTGTCCTGCTTACCTTCTTGGAATTTTACGAGACTCTTCTTGCCTTTATTAACTTCAAGCTTTACCATTCTCTGAATGTTAAATACCCGCCAATCCTTGACTCTCGGTTGGAGGCTTTGGCTGCAGATCTCTATGCACTGTCTAGATACATAGATGCCAGCTCCAGAGGCATGGCGGTGGAACCCAAAGTTGATGCTTCATTTAGCTCA
TRN  10010101100011000
NAM  Q8IIS5_PLAF7/7-292
ASQ  KKKIKKKKEGKYLTKKHILRKLFLNEEEFRKLCIFKGIYPKDFKEIPLKYRKKFYKHKVFYTRNDFLKLSHEKIINDFRKIKIYLKKYKKCKLTLEDFTRSKNIVAN--FPVYKLEHIIKERYPILSYAVDHLDDALSCIIAYSQLPSNHKY--------GIKNNMVKTCEMLKDHFHYYVYKTNRIKKAFISVKGYYLQAEILKKKVTWIIPH--IFTPYLDTSIDFKLISDFIEYYIALLKFVLFKLYKLDNMLYPPKQDNDLKNEKLAHLSYDKDYSTNENNIDINMNQELQSKC
DSQ  AAGAAGAAAATTAAAAAGAAGAAGGAAGGGAAGTACCTAACAAAAAAACACATCCTAAGGAAATTATTTTTGAATGAAGAAGAATTTCGTAAGCTTTGTATTTTTAAAGGAATATATCCAAAAGATTTTAAAGAAATTCCTTTGAAATATCGAAAAAAATTTTATAAACATAAAGTGTTTTATACTAGAAATGATTTTTTAAAATTATCACATGAAAAAATAATTAATGATTTTAGAAAAATAAAAATATATTTAAAAAAATATAAAAAATGTAAATTAACCTTAGAAGATTTTACTCGTTCTAAAAATATTGTAGCAAAC------TTCCCTGTATATAAATTAGAACATATAATAAAAGAACGATATCCTATATTGTCATATGCTGTAGATCATTTAGATGATGCCTTAAGTTGTATTATTGCTTACTCACAATTACCTTCCAATCATAAATAT------------------------GGTATTAAAAATAATATGGTTAAAACATGTGAAATGTTGAAAGACCATTTTCATTATTATGTATATAAGACCAATAGAATTAAAAAAGCCTTTATAAGTGTTAAAGGATATTATTTACAAGCAGAAATTTTAAAGAAAAAAGTCACATGGATTATACCACAT------ATATTCACACCTTATTTAGATACATCAATTGATTTTAAATTAATATCCGATTTTATTGAATATTACATAGCCCTCTTGAAATTTGTATTATTCAAATTATATAAGCTTGATAATATGTTATATCCACCAAAACAAGATAACGACTTGAAAAATGAAAAACTCGCTCACCTATCTTATGACAAAGATTATAGTACAAACGAGAATAATATAGATATCAACATGAATCAAGAACTACAAAGCAAATGT
TRN  10010101110011000
NAM  O97209_LEIMA/11-301
ASQ  RVKKER-FKKKFLTRMQATRLLQMESVQFRRLCILKGIYPRALNR-SKQKQSGN--EKQYYLAREIKWLVRDQIAEKMMAYRAWEKKVKRAE-AMGRSEDLKVLQTSRVKPRHSLVATIKERYPYFIDAIRDVDDAMSMIHLYAFLSPEIKSDTTIEIHHSLTSGLSERAKEVCERWDRYVARARVLTKGFISIKGYYYEAIVKGERVRWLCPH--EYAHRFPPGIQQYVMLSFLEFYLEMMKFVLFKLESDLARDEADRLAAEDEEGVTRANAEDFANGAALAVLDVGANQAQAKAV
DSQ  CGGGTGAAGAAGGAGCGC---TTCAAGAAGAAATTTCTGACGCGCATGCAGGCGACGCGGCTACTGCAGATGGAGTCCGTTCAGTTCCGCCGCCTCTGCATCCTCAAGGGCATCTACCCCCGCGCCCTCAACCGC---AGCAAGCAGAAACAAAGTGGGAAC------GAGAAGCAGTACTATCTCGCCCGTGAGATCAAGTGGCTGGTGCGCGACCAGATAGCGGAGAAGATGATGGCATATCGGGCATGGGAGAAGAAGGTGAAGCGGGCAGAG---GCGATGGGCCGCTCCGAGGACCTCAAGGTGCTGCAGACCTCACGCGTGAAGCCGCGCCACAGCCTGGTGGCGACGATCAAGGAGCGCTACCCATACTTCATCGACGCCATCCGTGACGTGGATGACGCCATGTCGATGATCCACCTTTACGCCTTCCTTAGCCCGGAGATCAAGTCCGATACCACCATCGAGATACATCACTCCCTCACCTCCGGCCTGAGCGAGAGGGCCAAGGAGGTGTGCGAACGCTGGGACCGCTACGTCGCACGCGCGCGTGTACTGACGAAGGGCTTCATCTCCATCAAGGGCTACTACTACGAGGCGATTGTCAAGGGCGAGCGGGTGCGGTGGCTGTGCCCGCAC------GAGTACGCTCACCGCTTCCCCCCGGGCATCCAGCAATACGTGATGCTCAGCTTCCTCGAATTCTACCTGGAGATGATGAAGTTCGTCCTGTTCAAGCTCGAGTCGGACCTCGCGCGCGATGAGGCGGACCGCCTGGCGGCCGAGGATGAGGAAGGTGTGACCCGCGCGAACGCCGAGGACTTCGCGAACGGTGCGGCGCTGGCCGTGCTGGATGTAGGCGCGAACCAGGCGCAGGCCAAGGCGGTG
TRN  10010101100011001
//