EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06719 - AraC_N)
FAM  PF06719
PID  AraC_N
DES  AraC-type transcriptional regulator N-terminus
IPR  IPR009594
ANO  24
ALN  159
AID  0.331449
APH  ((((((((Q88N21_PSEPK/34-188:0.42798,Q9I268_PSEAE/58-212:0.23691):0.29344,(Q8U6C7_AGRT5/23-177:0.30550,(Q8PIQ6_XANAC/38-193:0.23005,Q8P7D5_XANCP/24-179:0.10399):0.30473):0.32468):0.08694,(((Q98IX9_RHILO/23-175:0.25599,Q98H75_RHILO/23-172:0.39377):0.22290,(Q8XW77_RALSO/23-176:0.12683,Q880S9_PSESM/23-176:0.18297):0.48498):0.22282,(((Q880S7_PSESM/38-192:0.75399,Q92WK9_RHIME/38-192:0.65864):0.15918,(Q8Y1R4_RALSO/38-192:0.58992,(Q9X0A0_THEMA/26-179:0.48885,Q87FG6_VIBPA/35-189:0.37904):0.06119):0.09401):0.15720,(Q8UDU8_AGRT5/27-182:0.53775,Q92MD3_RHIME/28-182:0.39506):0.21959):0.11991):0.09046):0.50898,Q9I3W4_PSEAE/35-189:0.57401):0.14605,(Q884B2_PSESM/29-184:0.20392,Q88K66_PSEPK/29-184:0.16922):0.45843):0.10057,(Q8ZI37_YERPE/27-181:0.31389,Q8FDL2_ECOL6/102-256:0.30107):0.41410):0.06323,Q9I1J8_PSEAE/24-181:0.38529):0.65491,Q87HX6_VIBPA/30-186:0.29220,Q8D7E2_VIBVU/26-183:0.20789);
ATP  ((((((((Q88N21_PSEPK/34-188,Q9I268_PSEAE/58-212),(Q8U6C7_AGRT5/23-177,(Q8PIQ6_XANAC/38-193,Q8P7D5_XANCP/24-179))),(((Q98IX9_RHILO/23-175,Q98H75_RHILO/23-172),(Q8XW77_RALSO/23-176,Q880S9_PSESM/23-176)),(((Q880S7_PSESM/38-192,Q92WK9_RHIME/38-192),(Q8Y1R4_RALSO/38-192,(Q9X0A0_THEMA/26-179,Q87FG6_VIBPA/35-189))),(Q8UDU8_AGRT5/27-182,Q92MD3_RHIME/28-182)))),Q9I3W4_PSEAE/35-189),(Q884B2_PSESM/29-184,Q88K66_PSEPK/29-184)),(Q8ZI37_YERPE/27-181,Q8FDL2_ECOL6/102-256)),Q9I1J8_PSEAE/24-181),Q87HX6_VIBPA/30-186,Q8D7E2_VIBVU/26-183);
ATL  13.7214
DNO  24
DLN  477
DID  0.454462
DPH  (((((((((((Q87FG6_VIBPA/35-189:0.38862,Q9X0A0_THEMA/26-179:0.40542):0.09307,(Q880S7_PSESM/38-192:0.49421,Q92WK9_RHIME/38-192:0.43090):0.08442):0.03731,Q8Y1R4_RALSO/38-192:0.42931):0.11219,(Q8UDU8_AGRT5/27-182:0.42619,Q92MD3_RHIME/28-182:0.26831):0.08321):0.12363,((Q88N21_PSEPK/34-188:0.30058,Q9I268_PSEAE/58-212:0.19836):0.16606,(Q8U6C7_AGRT5/23-177:0.40158,(Q8PIQ6_XANAC/38-193:0.15194,Q8P7D5_XANCP/24-179:0.15660):0.18066):0.15366):0.05237):0.05749,((Q98IX9_RHILO/23-175:0.17614,Q98H75_RHILO/23-172:0.31006):0.09857,(Q8XW77_RALSO/23-176:0.19020,Q880S9_PSESM/23-176:0.13922):0.30471):0.10986):0.23811,Q9I3W4_PSEAE/35-189:0.31102):0.10184,(Q884B2_PSESM/29-184:0.21260,Q88K66_PSEPK/29-184:0.16568):0.26097):0.06858,Q9I1J8_PSEAE/24-181:0.25979):0.06902,(Q8ZI37_YERPE/27-181:0.34140,Q8FDL2_ECOL6/102-256:0.24387):0.25045):0.39718,Q87HX6_VIBPA/30-186:0.31961,Q8D7E2_VIBVU/26-183:0.18651);
DTP  (((((((((((Q87FG6_VIBPA/35-189,Q9X0A0_THEMA/26-179),(Q880S7_PSESM/38-192,Q92WK9_RHIME/38-192)),Q8Y1R4_RALSO/38-192),(Q8UDU8_AGRT5/27-182,Q92MD3_RHIME/28-182)),((Q88N21_PSEPK/34-188,Q9I268_PSEAE/58-212),(Q8U6C7_AGRT5/23-177,(Q8PIQ6_XANAC/38-193,Q8P7D5_XANCP/24-179)))),((Q98IX9_RHILO/23-175,Q98H75_RHILO/23-172),(Q8XW77_RALSO/23-176,Q880S9_PSESM/23-176))),Q9I3W4_PSEAE/35-189),(Q884B2_PSESM/29-184,Q88K66_PSEPK/29-184)),Q9I1J8_PSEAE/24-181),(Q8ZI37_YERPE/27-181,Q8FDL2_ECOL6/102-256)),Q87HX6_VIBPA/30-186,Q8D7E2_VIBVU/26-183);
DTL  9.95172
RID  0.331449
RPH  ((((((((Q88N21_PSEPK/34-188:0.42798,Q9I268_PSEAE/58-212:0.23691):0.29344,(Q8U6C7_AGRT5/23-177:0.30550,(Q8PIQ6_XANAC/38-193:0.23005,Q8P7D5_XANCP/24-179:0.10399):0.30473):0.32468):0.08694,(((Q98IX9_RHILO/23-175:0.25599,Q98H75_RHILO/23-172:0.39377):0.22290,(Q8XW77_RALSO/23-176:0.12683,Q880S9_PSESM/23-176:0.18297):0.48498):0.22282,(((Q880S7_PSESM/38-192:0.75399,Q92WK9_RHIME/38-192:0.65864):0.15918,(Q8Y1R4_RALSO/38-192:0.58992,(Q9X0A0_THEMA/26-179:0.48885,Q87FG6_VIBPA/35-189:0.37904):0.06119):0.09401):0.15720,(Q8UDU8_AGRT5/27-182:0.53775,Q92MD3_RHIME/28-182:0.39506):0.21959):0.11991):0.09046):0.50898,Q9I3W4_PSEAE/35-189:0.57401):0.14605,(Q884B2_PSESM/29-184:0.20392,Q88K66_PSEPK/29-184:0.16922):0.45843):0.10057,(Q8ZI37_YERPE/27-181:0.31389,Q8FDL2_ECOL6/102-256:0.30107):0.41410):0.06323,Q9I1J8_PSEAE/24-181:0.38529):0.65491,Q87HX6_VIBPA/30-186:0.29220,Q8D7E2_VIBVU/26-183:0.20789);
RTP  ((((((((Q88N21_PSEPK/34-188,Q9I268_PSEAE/58-212),(Q8U6C7_AGRT5/23-177,(Q8PIQ6_XANAC/38-193,Q8P7D5_XANCP/24-179))),(((Q98IX9_RHILO/23-175,Q98H75_RHILO/23-172),(Q8XW77_RALSO/23-176,Q880S9_PSESM/23-176)),(((Q880S7_PSESM/38-192,Q92WK9_RHIME/38-192),(Q8Y1R4_RALSO/38-192,(Q9X0A0_THEMA/26-179,Q87FG6_VIBPA/35-189))),(Q8UDU8_AGRT5/27-182,Q92MD3_RHIME/28-182)))),Q9I3W4_PSEAE/35-189),(Q884B2_PSESM/29-184,Q88K66_PSEPK/29-184)),(Q8ZI37_YERPE/27-181,Q8FDL2_ECOL6/102-256)),Q9I1J8_PSEAE/24-181),Q87HX6_VIBPA/30-186,Q8D7E2_VIBVU/26-183);
RTL  13.7214
LNK  Q87FG6_VIBPA/35-189:Q87FG6:BA000032
LNK  Q87HX6_VIBPA/30-186:Q87HX6:BA000032
LNK  Q880S7_PSESM/38-192:Q880S7:AE016867
LNK  Q880S9_PSESM/23-176:Q880S9:AE016867
LNK  Q884B2_PSESM/29-184:Q884B2:AE016863
LNK  Q88K66_PSEPK/29-184:Q88K66:AE016783
LNK  Q88N21_PSEPK/34-188:Q88N21:AE016779
LNK  Q8D7E2_VIBVU/26-183:Q8D7E2:AE016808
LNK  Q8FDL2_ECOL6/102-256:Q8FDL2:AE016766
LNK  Q8P7D5_XANCP/24-179:Q8P7D5:AE012380
LNK  Q8PIQ6_XANAC/38-193:Q8PIQ6:AE011925
LNK  Q8U6C7_AGRT5/23-177:Q8U6C7:AE009416
LNK  Q8UDU8_AGRT5/27-182:Q8UDU8:AE009153
LNK  Q8XW77_RALSO/23-176:Q8XW77:AL646070
LNK  Q8Y1R4_RALSO/38-192:Q8Y1R4:AL646060
LNK  Q8ZI37_YERPE/27-181:Q8ZI37:AJ414144
LNK  Q92MD3_RHIME/28-182:Q92MD3:AL591791
LNK  Q92WK9_RHIME/38-192:Q92WK9:AL591985
LNK  Q98H75_RHILO/23-172:Q98H75:BA000012
LNK  Q98IX9_RHILO/23-175:Q98IX9:BA000012
LNK  Q9I1J8_PSEAE/24-181:Q9I1J8:AE004653
LNK  Q9I268_PSEAE/58-212:Q9I268:AE004631
LNK  Q9I3W4_PSEAE/35-189:Q9I3W4:AE004567
LNK  Q9X0A0_THEMA/26-179:Q9X0A0:AE001762
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q88K66_PSEPK/29-184
ASQ  TLLPQVQVLSWDHYVASSPQIYEPSLMIVAQGSKLARLGPRTLEYGAGHYLVQALSVPFMCETF-ATREAPLLGVAVGIDRGVLGELVQSMGLAPD-.AEVQAQTPQSMTSAALDAPMRESVERLLHCLQDPLDAKVLGPARVREVLYTALRGPQAGVL
DSQ  ACCCTCCTGCCCCAAGTGCAGGTGTTGAGCTGGGACCACTATGTGGCCAGCAGCCCACAGATTTACGAACCCAGCCTCATGATCGTGGCCCAGGGCAGCAAGCTGGCACGCCTGGGGCCGCGTACCCTGGAGTACGGTGCAGGGCATTACCTGGTGCAGGCGTTGTCGGTGCCGTTCATGTGTGAAACCTTT---GCCACCCGCGAGGCGCCGCTGTTGGGCGTGGCGGTGGGCATCGACCGTGGCGTGCTGGGCGAGTTGGTGCAGAGCATGGGCTTGGCACCGGAC---...GCTGAAGTGCAGGCGCAAACCCCGCAATCGATGACCTCGGCGGCACTGGATGCACCCATGCGCGAAAGTGTGGAACGGCTGCTGCACTGCCTGCAGGACCCGCTTGACGCCAAGGTACTGGGCCCGGCGCGCGTACGCGAGGTGCTGTATACCGCGCTGCGCGGCCCGCAGGCCGGTGTGTTG
TRN  11011111101111111
NAM  Q884B2_PSESM/29-184
ASQ  THLPAVRVLSAFGYVASSPQIYEPSLMIVVQGSKVACLGPRTFEYGTGHYLIQALSVPFKCETF-ATPGKPLYGVSVAIDRVLLGELVQAMGPASG-.QESQMQTPESMTSVRIDPAMRDSVERLLRCLHDPLECQAMGQARIREVLYSALRGPQSGVL
DSQ  ACGCATTTGCCCGCGGTCCGTGTGCTGTCGGCTTTTGGTTATGTGGCCAGTAGCCCGCAGATCTACGAGCCGAGCCTGATGATTGTGGTGCAGGGCAGCAAAGTCGCCTGTCTGGGGCCGCGCACTTTTGAATACGGCACTGGGCATTACCTGATTCAGGCGCTGTCGGTGCCGTTCAAATGCGAGACCTTC---GCCACCCCGGGCAAGCCGCTGTATGGCGTGTCGGTGGCCATCGACCGCGTGCTGCTTGGCGAGCTGGTGCAAGCGATGGGCCCGGCCAGCGGC---...CAGGAAAGCCAGATGCAGACCCCGGAGTCCATGACATCGGTACGCATCGACCCTGCGATGCGCGACAGCGTCGAACGCCTGTTGCGCTGTCTGCACGATCCGCTGGAGTGTCAGGCGATGGGGCAGGCGCGCATTCGTGAAGTGCTGTACAGCGCGCTACGCGGCCCGCAATCGGGTGTATTG
TRN  11011101101011011
NAM  Q9I1J8_PSEAE/24-181
ASQ  TRIPGVRLMRAEQAYPRSPVFYEPRICILAQGQKIGFLGGETYRYDAERYLVMSVPLPFECET-HASAAEPLLGVSVDVDIGTLKELLLQMEEAPGSdDDNELAPSAPMASVPLDAGMADAVMRLLGCLQSPLDSHILGPQLVREIIFRALRSEQGNAL
DSQ  ACCCGCATCCCCGGGGTTCGCCTGATGCGCGCCGAACAGGCCTATCCGCGCAGCCCGGTGTTCTATGAGCCGCGCATCTGCATCCTCGCCCAGGGCCAGAAGATCGGTTTCCTCGGCGGCGAAACCTACCGCTACGACGCCGAACGCTACCTGGTGATGTCGGTGCCCCTGCCGTTCGAATGCGAAACC---CACGCCTCCGCCGCCGAACCCTTGCTGGGAGTGAGCGTCGACGTGGATATCGGCACCTTGAAGGAACTGCTGCTACAGATGGAAGAGGCTCCCGGCAGCgacGACGACAATGAGCTGGCACCCAGCGCGCCGATGGCTTCGGTACCGCTGGACGCGGGGATGGCCGATGCGGTGATGCGCCTGCTGGGCTGCCTGCAGAGCCCGCTGGACAGCCATATCCTCGGCCCGCAACTGGTCCGCGAGATCATCTTCCGCGCCCTGCGCAGCGAGCAGGGCAACGCCCTG
TRN  11011111101111111
NAM  Q9I3W4_PSEAE/35-189
ASQ  TGLDCVRLLRSDRPLARTPVLYDPGIVIVCQGRKRGYFGEQIYLYDEQHYLAVAVPVPFTMET-DATPERPLLAIYLHLDFPLAAGLAVEIDRQRA-.-LAQVEAPRSLMSSPMDAPLRASVLRFLEALGDPLETAILAPALLRELYFRVLTGPQGGAM
DSQ  ACCGGGCTCGACTGCGTCCGCCTGCTGCGTTCGGATCGTCCGCTGGCGCGGACGCCGGTGCTCTACGATCCGGGGATCGTCATCGTTTGCCAGGGGCGAAAGCGCGGCTATTTCGGCGAGCAGATCTACCTGTACGACGAGCAGCACTACCTGGCCGTGGCGGTGCCGGTGCCGTTCACCATGGAGACC---GATGCCACGCCAGAGCGACCGCTGCTGGCGATCTACCTGCACCTGGATTTCCCGCTGGCGGCCGGGCTGGCGGTGGAGATCGACCGTCAGCGCGCG---...---CTTGCGCAGGTCGAAGCGCCGCGCAGTCTGATGTCCAGCCCTATGGACGCGCCGCTGCGGGCATCGGTGTTGCGCTTCCTGGAGGCGCTGGGCGATCCTCTGGAGACAGCGATCCTCGCGCCTGCGCTACTGCGCGAGCTGTACTTCCGCGTGCTCACCGGCCCTCAGGGCGGCGCCATG
TRN  11011111101111111
NAM  Q8FDL2_ECOL6/102-256
ASQ  ELLPDVRLLYGETPFARTPVMYEPGIIILFSGHKIGYINERVFRYDANEYLLLTVPLPFECETY-ATSEVPLAGLRLNVDILQLQELLMDIGEDEH-.-FQPSMAASGINSATLSEEILCAAERLLDVMERPLDARILGKQIIREILYYVLTGPCGGAL
DSQ  GAGCTGTTGCCCGATGTGCGTTTGTTGTATGGCGAGACGCCTTTCGCACGCACACCGGTGATGTACGAGCCTGGCATCATAATTCTCTTTTCCGGACATAAAATCGGTTATATCAATGAACGCGTGTTTCGTTATGACGCTAATGAATATCTCCTGCTGACGGTGCCGTTGCCGTTTGAGTGCGAAACCTAT---GCCACGTCAGAGGTGCCGCTGGCAGGGTTGCGTCTCAATGTCGATATTTTGCAGTTACAGGAACTGTTGATGGACATTGGCGAAGATGAACAT---...---TTTCAGCCGTCAATGGCAGCCAGCGGTATTAACTCCGCCACGTTATCAGAAGAGATTTTATGCGCGGCAGAGCGGTTACTGGATGTGATGGAGCGACCGCTGGATGCGCGCATTCTCGGCAAACAGATTATCCGCGAAATTCTGTACTACGTGCTGACCGGACCTTGCGGCGGCGCGTTA
TRN  10010101100011000
NAM  Q8ZI37_YERPE/27-181
ASQ  STVSGVKILYSTVHQPRTPVMYTPSVVIIFQGHKVGYLGSKVFQYDPKNYLILSVPLPFECETF-ASPEIPLAGISIQVDSQMLQDLMMTMGDDEL-.-EKPPGNTSGVNSAPLTEEMLCATERLLDVMSIARDARVLGPQIVREILYYVLCGSCGGAL
DSQ  TCAACGGTATCCGGGGTGAAAATTTTGTACTCTACAGTGCATCAACCGCGAACACCGGTAATGTACACCCCCAGTGTGGTGATTATATTTCAGGGACACAAAGTGGGTTATCTGGGTAGTAAAGTGTTTCAGTATGATCCCAAAAACTACCTCATCCTGAGTGTTCCGCTGCCGTTTGAGTGTGAAACGTTT---GCCAGCCCTGAAATACCATTGGCCGGGATTTCCATTCAAGTAGACAGCCAGATGTTACAAGATTTGATGATGACTATGGGGGATGACGAGCTG---...---GAAAAACCGCCGGGCAATACCTCGGGTGTGAACTCTGCCCCTCTGACTGAAGAGATGCTGTGTGCAACAGAACGGCTCTTGGATGTGATGTCCATTGCCCGTGATGCCCGCGTCCTTGGTCCGCAAATTGTGCGAGAAATTCTCTACTACGTCTTGTGTGGGTCATGCGGTGGGGCCTTG
TRN  10010101100011000
NAM  Q8D7E2_VIBVU/26-183
ASQ  TDIPGVRFYRSSRGNPRHPFVYQSGIIVLGQGYKNIHIGDHAVCYGADDYLVVGVPMPLECEAF-ADDDKPLLGISVDVPMVLLQQMVQKLEKHGYQnICSGKEESCGLKSVKMEASMLNACKRLMRGLCDPLETEVLGQSLLEEVVYRALLSPKGYVL
DSQ  ACCGACATACCTGGGGTTCGTTTTTATCGAAGCAGCCGAGGTAATCCACGGCACCCATTTGTTTATCAATCTGGAATTATTGTACTCGGGCAGGGTTACAAAAATATTCATATTGGTGATCATGCTGTGTGCTATGGCGCAGATGATTATTTGGTGGTGGGTGTGCCAATGCCGCTCGAATGTGAAGCGTTT---GCGGATGACGATAAGCCTTTGCTGGGGATCTCTGTTGATGTACCAATGGTTTTGCTGCAGCAAATGGTTCAGAAGCTAGAAAAGCACGGCTACCAAaatATTTGCAGTGGCAAAGAAGAAAGCTGCGGCTTGAAGTCGGTGAAAATGGAAGCGAGCATGCTTAACGCTTGCAAGCGCTTAATGCGGGGATTGTGTGATCCTCTTGAAACTGAAGTGCTAGGCCAATCATTACTAGAAGAGGTGGTTTATCGTGCGTTACTGAGCCCTAAAGGCTATGTGCTG
TRN  10010101100011000
NAM  Q87HX6_VIBPA/30-186
ASQ  TAIEGVWFYRSSKGNNRQPFVYQSGIIVLGQGHKNIHIGQTPVQYGPDDYLVVGVPMPLECEAF-ATNNEPLLGISIDISPTLLHKLVKKL-EAQKFsNICEDSKRCGLKSVRMNDAMLDACKRLMKALCNDLDVAILGESLLEEIVYRTLVSKEGYVL
DSQ  ACTGCTATCGAAGGCGTTTGGTTTTATCGCAGTAGCAAAGGCAATAACCGTCAACCATTTGTGTATCAATCAGGGATCATTGTGCTTGGCCAAGGGCATAAAAACATCCATATAGGGCAAACGCCAGTTCAGTATGGTCCGGATGACTATTTGGTGGTGGGTGTACCTATGCCTCTAGAGTGTGAAGCATTT---GCCACCAACAATGAGCCTTTGCTCGGTATTTCTATCGACATCTCGCCAACGTTGCTGCACAAACTTGTGAAAAAGCTC---GAAGCACAGAAATTCagtAATATCTGCGAAGATTCTAAACGTTGTGGCCTCAAATCGGTTCGAATGAACGACGCCATGCTCGATGCTTGCAAGCGATTAATGAAGGCGCTTTGCAACGATTTGGATGTGGCGATATTGGGCGAGTCCTTACTAGAAGAAATTGTCTATCGAACGCTTGTAAGTAAAGAAGGGTACGTGTTG
TRN  10010101100011000
NAM  Q880S9_PSESM/23-176
ASQ  TPIPRVDICVGQGFTEKAPCLYRSMICFILQGSKRVAINDNLLSYDSEHYLISALDLPLIGQILDAEDGQPYVAVSLVLDPALLAVLAASMPAVRE-.---REQKGIGITINPMSAPLRDTLLRLLSLLDTPDDIPILAPMVERELLYRLLQGPQGRLL
DSQ  ACGCCGATCCCACGGGTGGATATCTGCGTCGGCCAGGGCTTTACCGAAAAGGCGCCGTGCCTGTATCGCTCAATGATCTGCTTCATCCTGCAAGGGTCGAAGCGCGTTGCGATCAACGACAATCTTCTGAGCTACGACAGCGAGCACTACCTGATCAGCGCCCTGGACCTGCCTTTGATCGGGCAGATTCTTGATGCCGAAGACGGGCAACCTTATGTTGCGGTATCGCTCGTGCTGGACCCGGCCTTATTGGCGGTACTGGCGGCGAGCATGCCTGCGGTTCGCGAG---...---------CGGGAGCAGAAAGGCATTGGCATCACGATCAACCCGATGAGCGCGCCGCTGCGAGACACCTTGCTGCGCTTGTTGTCATTGCTCGACACGCCTGACGATATCCCGATTCTGGCGCCCATGGTCGAACGGGAGTTGCTCTATCGTCTTCTTCAAGGGCCTCAAGGGCGGCTGTTG
TRN  11011101101011000
NAM  Q8XW77_RALSO/23-176
ASQ  TPIPRLELSVGSASAGKAPCLYRSMICFILQGSKRVAINDELLGYDSAQYLISALELPLSGEILDAGPGKPYVAVSLVLEPVLLAELVAAMPSARE-.---SESHGSGIAINPMNAPLRESLLRLLSLLDTPSDVPVLAAMMERELLYRLLQGPQGRLL
DSQ  ACGCCGATTCCACGGCTTGAACTGAGTGTGGGTAGCGCCTCTGCAGGCAAGGCACCGTGTCTTTATCGCTCGATGATCTGCTTCATCCTGCAAGGGTCCAAGCGTGTAGCGATCAACGACGAGCTTCTGGGCTACGACAGCGCGCAGTATCTGATCAGTGCCCTCGAACTACCTCTCAGCGGTGAGATCCTCGATGCAGGTCCAGGGAAACCCTATGTCGCCGTATCGCTGGTACTTGAACCTGTTTTATTGGCAGAGCTGGTGGCCGCCATGCCCTCGGCACGTGAA---...---------AGCGAATCGCATGGCTCCGGCATTGCAATCAATCCGATGAACGCCCCGCTGCGTGAGTCGTTGCTTCGCTTGCTCTCGTTACTCGATACGCCGTCTGACGTCCCGGTTCTCGCTGCCATGATGGAGCGGGAGTTGCTTTATCGTCTCTTGCAAGGTCCGCAGGGACGGTTGCTG
TRN  11011101101011010
NAM  Q98H75_RHILO/23-172
ASQ  TAIPRVTIGRSEVATPPLPELCQPTALFVLQGAKTVLIGDRTLRYGAGSYFVYAVETPATSQLIEASSARPYMAIAFALDVGLIASLLIDHTPAVD-.-------GDSFVTNRLDDELLDAWRRMLRLLDRPAEIPVLAPMLEREIAFRLLQGPQGAKL
DSQ  ACGGCCATCCCGCGTGTCACCATCGGCCGCAGCGAGGTTGCGACTCCGCCACTGCCCGAGCTTTGTCAGCCGACGGCGCTGTTCGTGCTGCAAGGTGCGAAGACTGTGCTGATCGGCGACCGCACGCTTCGCTACGGCGCCGGCAGCTATTTCGTCTATGCGGTGGAGACGCCCGCCACCAGCCAGCTGATCGAGGCGAGCAGCGCCCGTCCTTACATGGCCATCGCCTTCGCCCTCGATGTCGGACTGATCGCCAGCCTGCTTATCGACCACACACCGGCGGTCGAC---...---------------------GGCGACAGCTTCGTGACCAACCGGTTGGATGATGAACTGCTCGATGCCTGGCGCCGCATGCTGCGGCTGCTCGACCGTCCGGCTGAAATCCCGGTGCTGGCGCCCATGCTTGAACGCGAGATCGCATTCCGCCTGTTGCAAGGCCCGCAAGGCGCGAAGCTG
TRN  11011111101111111
NAM  Q98IX9_RHILO/23-175
ASQ  TGIPRVAIMKGEATTGPLLGLYDPRLCLVLQGAKSVMIGDQLLHYDAGRYFIAAVEVPAVGRVLQASPQHPYLSVSLAFDTTLIASLLLDMPPVAE-.----APIGHGFAVSRADEALVDAWLRMIELIDHPAEIPVLAPLLEREILFRLLQGPQGAML
DSQ  ACCGGCATCCCCCGCGTCGCCATCATGAAGGGCGAGGCGACGACCGGGCCGTTGCTGGGGCTCTACGACCCAAGGCTTTGCCTGGTCCTGCAGGGCGCCAAATCCGTCATGATCGGCGATCAGCTGCTGCATTACGACGCCGGCCGCTACTTCATTGCCGCGGTCGAAGTGCCGGCCGTCGGCAGGGTTTTGCAGGCCAGCCCACAGCATCCCTACCTCTCCGTCAGCCTGGCCTTCGACACCACGCTCATCGCCTCGCTGCTGCTCGACATGCCGCCCGTTGCCGAG---...------------GCGCCGATCGGCCATGGCTTTGCCGTCAGCCGGGCCGACGAGGCGCTGGTCGATGCGTGGCTGCGCATGATTGAGCTCATCGATCATCCGGCCGAAATCCCAGTGCTGGCGCCCTTGCTCGAACGCGAAATCCTCTTTCGGCTGCTGCAAGGTCCGCAAGGCGCCATGCTG
TRN  10010101100011011
NAM  Q92MD3_RHIME/28-182
ASQ  TIMPGLSVHRHSVSAKPNCAAYKPSLAIIVQGAKRVVLGEETLVYGASDYLLTSIDLPVLSQISLASPEEPYLSMVFQIDTTRLPALLDAIGPEAA-.--KAPASPRGMTVSKLTPDLEDTALRLLRLLDRPDDIAVLLPLVEQELLYRLLLGPHGARL
DSQ  ACGATTATGCCGGGGCTGAGCGTTCATCGGCATTCCGTTTCCGCGAAGCCGAATTGCGCCGCCTACAAGCCGAGCCTGGCGATCATCGTCCAGGGAGCCAAACGTGTCGTGCTCGGTGAGGAAACCCTCGTCTACGGCGCCTCGGACTACCTTTTGACCTCCATCGACCTGCCGGTTCTCTCTCAGATATCGCTCGCCTCGCCCGAGGAGCCCTATCTCAGCATGGTCTTCCAGATCGATACGACGAGGCTTCCGGCGCTCCTCGACGCCATCGGCCCGGAGGCTGCG---...------AAAGCTCCGGCTTCGCCGCGCGGCATGACGGTCAGCAAGCTCACTCCCGATCTTGAGGACACGGCGCTTCGGCTGCTGCGGCTCCTCGACCGCCCGGACGACATTGCGGTGCTGCTGCCGCTGGTCGAGCAGGAACTGCTTTATCGGCTGCTGCTCGGACCGCACGGCGCCAGGCTC
TRN  10010101100011011
NAM  Q8UDU8_AGRT5/27-182
ASQ  TAIESLGISRRTIPSAPCHGNYRPCLAMVIQGSKSVQLGTDTINYGAGDYLLTSLDLPVAWRVVEASREVPHFCIALAIDSEKLLDLMRRIPIDPS-.-SEPANAQRGIVVNRATPELLDAAIRLLRLLDRPADIAAMAPLIEQEILYRILTGPAGGQL
DSQ  ACGGCGATCGAATCCCTCGGCATCAGTCGGCGCACGATCCCCAGCGCACCATGCCACGGCAATTACCGCCCCTGTCTCGCTATGGTAATCCAGGGGTCGAAAAGCGTGCAATTGGGCACGGACACCATAAATTACGGCGCGGGTGATTATCTTCTGACATCGCTCGATCTGCCTGTTGCATGGCGGGTGGTGGAGGCGAGCCGGGAGGTGCCGCATTTCTGTATTGCCCTTGCCATCGATAGTGAAAAGCTGCTCGATCTCATGCGCCGCATACCGATCGATCCATCT---...---TCGGAGCCGGCGAATGCGCAGCGCGGCATCGTCGTCAACAGGGCAACACCGGAACTTCTCGATGCGGCCATACGGCTCCTGCGCTTGCTTGATCGTCCAGCCGACATCGCCGCCATGGCGCCGCTGATCGAGCAGGAGATCCTCTATCGCATCCTGACCGGACCGGCCGGCGGGCAATTG
TRN  10010101100011011
NAM  Q9I268_PSEAE/58-212
ASQ  TAVEPLALIRADGPTLPARGMHKPALCIIAQGRKEVQLAEERYIYDPLHYLVVSVTLPLAGQVIDASPDAPYLCVRLDIDPAEITQLISDAGPME--.-VASRRGDRGLYVDRIDASLLDAVLRLIHLLDSPRDIPMLAPLILREIFYRLLRSGQGQRL
DSQ  ACCGCCGTCGAACCCCTCGCCCTGATCCGCGCCGACGGCCCCACCCTGCCGGCGCGCGGCATGCACAAACCTGCCCTGTGCATCATCGCCCAGGGCCGCAAGGAGGTGCAGTTGGCCGAGGAACGCTATATCTACGATCCGTTGCACTACCTGGTGGTCTCGGTCACCCTGCCGCTGGCCGGCCAGGTGATCGACGCCTCGCCGGACGCGCCCTACCTCTGCGTCCGGCTGGATATCGACCCGGCGGAAATCACCCAGTTGATCTCCGACGCCGGGCCCATGGAA------...---GTGGCCAGCCGGCGCGGCGACCGCGGCCTCTACGTCGACCGTATCGACGCCAGCCTGCTGGATGCCGTGCTGCGCCTGATCCATCTGCTGGACAGCCCGCGCGACATCCCGATGCTGGCGCCGCTGATCCTCCGCGAGATTTTCTACCGGCTGCTGCGCAGCGGCCAGGGCCAGCGCCTG
TRN  11011101101011011
NAM  Q88N21_PSEPK/34-188
ASQ  SAIDDLYLVRYTENVRSVPTLAQPALCILAQGSKSLFLGDEQYAYDPLHYMVVSVTLPLSAVRLDASPENPSLGLRMDLDPAEISQLIAESGPMLV-.--PNRPSGRGLYVERTDAALLDALLRLLRLLDTPRDIAMLAPLFRREILYRLLRGPQGYRL
DSQ  TCGGCCATCGATGACCTGTACCTGGTGCGTTACACCGAAAATGTACGTTCTGTACCCACCCTGGCGCAGCCTGCCCTGTGCATCCTTGCCCAGGGCAGCAAAAGCCTGTTCCTGGGTGACGAGCAGTACGCCTACGACCCACTGCATTACATGGTCGTTTCGGTGACCTTGCCACTCAGCGCCGTGAGGCTGGATGCCAGCCCCGAGAACCCAAGCCTGGGCCTGCGCATGGACCTGGACCCGGCGGAGATCAGCCAACTGATCGCCGAGAGCGGGCCAATGCTGGTA---...------CCCAATCGACCTTCCGGCCGTGGTTTGTATGTGGAAAGGACAGATGCCGCGTTACTCGATGCCCTGCTGCGGTTGCTGCGGCTGCTGGACACCCCTCGCGACATCGCAATGCTGGCGCCGCTGTTCCGCCGCGAGATTCTCTACCGCCTGCTGCGTGGGCCGCAGGGTTACCGGCTG
TRN  10010101100011010
NAM  Q8P7D5_XANCP/24-179
ASQ  TAVPGLRLMRCSAPTYSIPTVYTPTLCLVAQGHKQAMLGTTAYHYHPAMYLVASVDLPIIGSVIEASPAQPYLCFCLDLDVAVLSDLAIRYPALAE-.-QAGDTPASGLLLNRSTPELHDAALRLARLLDQPRDIDALAPLVLRELLYRLMAEPGNAIV
DSQ  ACGGCCGTGCCCGGGCTGCGGCTGATGCGCTGCTCCGCGCCCACCTACTCCATCCCCACGGTGTACACGCCCACCCTGTGCCTGGTCGCGCAGGGGCACAAGCAGGCCATGCTCGGTACCACCGCGTATCACTACCATCCGGCGATGTATCTGGTGGCCTCTGTGGACCTGCCGATCATCGGCTCGGTGATCGAAGCGAGCCCGGCCCAGCCGTATCTGTGTTTTTGCCTGGATCTGGACGTGGCCGTGCTCAGCGACCTTGCGATCCGTTACCCGGCCCTGGCCGAG---...---CAGGCTGGCGACACGCCAGCGTCCGGACTGTTGCTCAATCGCAGCACGCCGGAGTTGCACGACGCCGCCTTGCGGCTGGCGCGCCTGCTCGACCAGCCGCGCGACATCGACGCGCTGGCGCCGCTGGTACTGCGCGAATTGCTGTACCGGCTGATGGCCGAACCGGGCAATGCCATCGTG
TRN  11011111101111111
NAM  Q8PIQ6_XANAC/38-193
ASQ  TQIAGLQIMRSASPTVAMPTVYTPMLCLVAQGRKQAMLGAQAYFYHPQMYLVASVDLPIVGSVIEASGAQPYLCFCLDLDTAVLSELAINHPELVD-.-TQRDAASAGLLLNRSTPQLQDAALRLARLLDQPHEIAALAPLIVRELLYRLMADPANAAV
DSQ  ACGCAGATCGCCGGGTTGCAGATCATGCGTAGCGCATCGCCGACCGTAGCCATGCCCACTGTCTACACACCCATGCTGTGCCTGGTGGCGCAAGGCCGCAAGCAGGCAATGCTCGGCGCGCAGGCGTACTTCTATCACCCGCAGATGTACCTGGTGGCGTCGGTGGATCTGCCCATCGTCGGCTCGGTAATCGAAGCCAGCGGCGCGCAACCGTATCTATGCTTCTGCCTGGACCTGGACACCGCGGTGCTCAGCGAGCTGGCGATCAACCATCCGGAACTGGTGGAC---...---ACGCAGCGCGATGCGGCATCGGCCGGGCTGTTACTCAATCGCAGCACGCCGCAGTTGCAGGACGCGGCGCTACGGCTGGCGCGCCTGCTCGATCAACCGCATGAAATTGCCGCGCTCGCGCCCTTGATCGTGCGCGAACTGCTGTACCGCCTGATGGCCGACCCGGCCAATGCGGCGGTG
TRN  11011111101111110
NAM  Q8U6C7_AGRT5/23-177
ASQ  TQLPGLKLIRCSETTLPMPVVYEPTLCLVAQGRKQAVLGQTSFVYDPSSYLVASVDLPVMGSVIEASKDKPYLSMQLDLDTVELADLAIRYPSEQH-.--APINGPIGLLLNKVDEGIIDAASRLLALLDTPRDIDALSPLAKREILYRLITGVGGAAL
DSQ  ACGCAGCTGCCGGGGTTGAAGCTCATTCGCTGTTCCGAGACGACATTGCCGATGCCTGTCGTCTACGAGCCGACACTTTGCCTCGTCGCACAGGGGCGAAAGCAGGCGGTTCTCGGGCAGACAAGCTTTGTCTATGATCCCTCCAGCTATCTGGTCGCCTCCGTTGATCTTCCGGTCATGGGATCGGTAATCGAAGCATCGAAAGACAAACCTTATCTTTCGATGCAACTCGACCTTGACACCGTGGAGTTGGCGGATCTGGCAATTCGCTATCCTTCAGAACAGCAC---...------GCGCCAATCAACGGCCCTATCGGCCTGTTACTTAACAAGGTGGATGAGGGTATCATTGATGCCGCTTCGCGTCTCCTTGCGCTGCTGGACACGCCTCGAGATATCGACGCCCTTTCACCGCTGGCGAAGCGTGAGATATTATATCGTCTCATTACCGGTGTTGGAGGAGCGGCGTTG
TRN  10010101100011000
NAM  Q87FG6_VIBPA/35-189
ASQ  TPISGLRFSRWTTPTPPTSYTHNPSICLIAQGRKRVLLGEESFIYDANHFLISSVDLPIIANIIEASEEQPYLGLIMELDLTEISQLIVDSELA---.FTQSKEAQKGIAVGELSESLLDAFVRLAELLDEGQNIKILAPIIKREIFYRLLMSEQGTRL
DSQ  ACGCCAATTTCGGGGTTGAGGTTCAGTCGTTGGACAACGCCGACGCCGCCTACGAGCTATACCCACAATCCAAGTATTTGTCTTATCGCGCAAGGCAGGAAGCGAGTCTTATTGGGAGAGGAAAGCTTTATTTACGATGCCAACCACTTCCTGATTTCTTCTGTCGATCTCCCTATCATTGCCAACATTATCGAAGCCAGTGAGGAGCAACCTTATTTAGGGCTGATCATGGAGCTGGATTTGACCGAGATTTCCCAACTGATTGTCGATAGCGAACTTGCC---------...TTTACTCAATCCAAAGAAGCGCAAAAAGGCATTGCTGTCGGTGAGTTGTCGGAATCTCTATTGGATGCGTTTGTACGTTTAGCAGAATTATTAGACGAAGGCCAAAACATCAAAATTTTAGCGCCCATCATTAAACGGGAGATTTTTTATCGCCTTTTGATGAGTGAACAGGGCACGCGTCTC
TRN  10010101100011010
NAM  Q9X0A0_THEMA/26-179
ASQ  RPLPGLTVGRRESPTEPSTYILPPSICIAVQGAKRVLIGEEYYVYDVENFLLNSFDVPVVAQVIEASKEKPYIGMTWEIDMEILMEIVVEQKLNTR-.---PITSSRGTSLGKVTHQLLDAFRRMLELLDEPEHISALLPVIKKEIIYRLLVSEQGPRL
DSQ  AGGCCACTTCCGGGTCTGACTGTGGGCAGGAGGGAGTCTCCTACAGAACCTTCCACTTACATCCTTCCGCCATCGATATGCATCGCTGTTCAGGGTGCAAAGCGCGTTCTCATTGGAGAAGAGTACTACGTTTACGACGTGGAGAATTTTCTTCTCAACTCCTTCGATGTTCCCGTCGTTGCTCAGGTGATAGAAGCTTCTAAGGAAAAACCTTATATCGGAATGACTTGGGAGATAGACATGGAGATCCTTATGGAAATCGTTGTTGAACAAAAGCTCAATACAAGA---...---------CCAATCACGTCATCCCGCGGTACATCACTGGGAAAAGTCACTCATCAGCTCCTGGACGCATTCAGAAGGATGCTGGAGCTCCTCGATGAACCGGAACACATTTCCGCACTCCTTCCCGTGATAAAAAAAGAGATCATCTATAGGCTCCTTGTGAGCGAACAGGGCCCGAGACTC
TRN  10010101100011001
NAM  Q8Y1R4_RALSO/38-192
ASQ  TSIPNLGLFRRDTAVEPCVCLVEPSVVLVAQGAKQLQVGDEAYTYDIERFLVTSLDMPAVSRVLDASPERPCLGLVFKLDLRITAELIAQSGLPPP-.--TEPAAERGMALGTLTPLLLEPLKRLVDLLDEPEAVPVLAPLIQREIHFRLLMSDQATRL
DSQ  ACATCGATCCCCAACCTGGGGCTTTTCCGGCGGGACACTGCCGTGGAGCCGTGCGTATGCCTGGTGGAGCCCAGTGTTGTTCTGGTTGCTCAGGGCGCCAAGCAACTACAGGTGGGTGATGAGGCATACACCTATGACATTGAGCGTTTTCTGGTCACATCGCTGGATATGCCCGCCGTTTCGCGCGTATTGGATGCCAGCCCGGAGAGGCCATGCCTGGGGCTGGTGTTCAAGCTCGACTTGCGGATCACCGCGGAGCTGATCGCACAGAGCGGCCTGCCGCCACCG---...------ACCGAGCCCGCTGCAGAACGAGGCATGGCGCTGGGTACCCTCACGCCGCTCCTGCTGGAGCCGCTGAAGCGATTGGTTGATTTGCTGGACGAGCCGGAGGCCGTTCCGGTACTTGCGCCGCTCATCCAGCGTGAAATTCATTTCCGCCTGCTGATGAGTGACCAGGCGACACGCCTG
TRN  10010101100011011
NAM  Q92WK9_RHIME/38-192
ASQ  HPVPGLSLYRIVEPAGPFSSVYEPSLSFIIKGSKNVRVGNETLVYDEGCFFLTAIGVPVTAQICAASEGEPYVAAALRLDMGKVRRIIADHDIHPT-.--DIPERDLGVAVGTATRELFDALFRLISLASSPADIPFLAGHIQNEILYRLLTGEQGARL
DSQ  CATCCCGTTCCAGGCCTGTCGCTCTATCGCATCGTCGAGCCGGCAGGCCCCTTTTCGAGCGTATACGAGCCGAGCCTCTCCTTCATCATCAAGGGCAGCAAGAATGTCCGCGTCGGCAACGAGACGCTCGTCTACGATGAAGGCTGCTTCTTCCTGACCGCCATCGGGGTTCCCGTAACTGCGCAGATCTGCGCAGCGAGCGAAGGGGAGCCCTATGTCGCAGCCGCCTTGCGGCTGGACATGGGAAAAGTGCGGCGCATCATTGCTGATCACGACATACACCCGACC---...------GACATTCCCGAACGCGACCTTGGTGTGGCTGTCGGTACCGCGACGCGCGAGCTCTTCGACGCCCTGTTCCGGCTGATTTCGCTTGCGAGCTCGCCGGCCGACATTCCGTTCCTGGCCGGCCATATCCAGAACGAGATCCTCTATCGGCTTCTCACCGGCGAGCAGGGCGCGCGGCTG
TRN  10010101100011011
NAM  Q880S7_PSESM/38-192
ASQ  TSIPDLTFYRMDKLATPTYCIYEPCVAIILQGAKEITFGEQACEFAQGSFFVTSVDIPTLARVTAASEQTPYLSIVLKLDLSMLNDVIQTQAPLKQ-.--EATPEARGFASGMASSEMLDAFARLSALTGQPLEAGLMSDLIKREICVRLLLSCAGQWL
DSQ  ACGTCCATTCCAGACCTCACCTTCTACCGAATGGACAAACTGGCCACGCCCACCTACTGCATTTACGAGCCCTGTGTGGCCATCATTCTGCAGGGCGCCAAGGAGATCACCTTCGGCGAGCAAGCCTGTGAGTTTGCGCAAGGGTCTTTCTTCGTCACATCGGTCGATATTCCGACGCTTGCTCGCGTTACTGCCGCCAGCGAGCAGACACCCTATTTATCCATTGTGTTGAAGCTCGATCTTTCCATGCTCAACGACGTTATCCAGACCCAGGCACCGCTGAAGCAA---...------GAGGCGACACCTGAGGCCCGAGGCTTTGCGTCTGGCATGGCATCAAGTGAAATGCTCGACGCCTTCGCTCGACTCTCCGCGTTGACCGGGCAGCCGCTGGAAGCAGGCTTGATGTCGGACCTTATCAAGCGGGAGATATGTGTTCGGTTGTTGCTGAGTTGCGCTGGCCAGTGGTTA
TRN  10010101100011000
//