EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06713 - DUF1200)
FAM  PF06713
PID  DUF1200
DES  Protein of unknown function (DUF1200)
IPR  IPR009589
ANO  8
ALN  114
AID  0.299104
APH  (((((Q9K9B1_BACHD/14-114:0.60826,Q8ELH5_OCEIH/28-127:0.67869):0.12237,(Q8CV26_OCEIH/33-133:0.93704,Q8EQJ6_OCEIH/24-123:0.48449):0.13986):0.21241,Q9KEX6_BACHD/37-136:0.57729):0.23253,Q99IS9_9ZZZZ/33-132:0.87691):0.47327,YYAB_BACSU/31-134:0.91080,Q8ETD0_OCEIH/30-139:1.31337);
ATP  (((((Q9K9B1_BACHD/14-114,Q8ELH5_OCEIH/28-127),(Q8CV26_OCEIH/33-133,Q8EQJ6_OCEIH/24-123)),Q9KEX6_BACHD/37-136),Q99IS9_9ZZZZ/33-132),YYAB_BACSU/31-134,Q8ETD0_OCEIH/30-139);
ATL  7.54488
DNO  8
DLN  342
DID  0.429495
DPH  (Q8EQJ6_OCEIH/24-123:0.38393,(Q8ELH5_OCEIH/28-127:0.46471,Q9KEX6_BACHD/37-136:0.39921):0.09461,((((YYAB_BACSU/31-134:0.68001,Q8ETD0_OCEIH/30-139:0.67674):0.13316,Q99IS9_9ZZZZ/33-132:0.53612):0.17323,Q9K9B1_BACHD/14-114:0.38207):0.18525,Q8CV26_OCEIH/33-133:0.51857):0.05946);
DTP  (Q8EQJ6_OCEIH/24-123,(Q8ELH5_OCEIH/28-127,Q9KEX6_BACHD/37-136),((((YYAB_BACSU/31-134,Q8ETD0_OCEIH/30-139),Q99IS9_9ZZZZ/33-132),Q9K9B1_BACHD/14-114),Q8CV26_OCEIH/33-133));
DTL  4.71713
RID  0.299104
RPH  (((((Q9K9B1_BACHD/14-114:0.60826,Q8ELH5_OCEIH/28-127:0.67869):0.12237,(Q8CV26_OCEIH/33-133:0.93704,Q8EQJ6_OCEIH/24-123:0.48449):0.13986):0.21241,Q9KEX6_BACHD/37-136:0.57729):0.23253,Q99IS9_9ZZZZ/33-132:0.87691):0.47327,YYAB_BACSU/31-134:0.91080,Q8ETD0_OCEIH/30-139:1.31337);
RTP  (((((Q9K9B1_BACHD/14-114,Q8ELH5_OCEIH/28-127),(Q8CV26_OCEIH/33-133,Q8EQJ6_OCEIH/24-123)),Q9KEX6_BACHD/37-136),Q99IS9_9ZZZZ/33-132),YYAB_BACSU/31-134,Q8ETD0_OCEIH/30-139);
RTL  7.54488
LNK  Q8CV26_OCEIH/33-133:Q8CV26:BA000028
LNK  Q8ELH5_OCEIH/28-127:Q8ELH5:BA000028
LNK  Q8EQJ6_OCEIH/24-123:Q8EQJ6:BA000028
LNK  Q8ETD0_OCEIH/30-139:Q8ETD0:BA000028
LNK  Q99IS9_9ZZZZ/33-132:Q99IS9:AF349105
LNK  Q9K9B1_BACHD/14-114:Q9K9B1:BA000004
LNK  Q9KEX6_BACHD/37-136:Q9KEX6:BA000004
LNK  YYAB_BACSU/31-134:P37523:X62539
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8ETD0_OCEIH/30-139
ASQ  LIPVIIFPFNWLILIILVG-VFVLSTLFILLPCFNLCYIFFYDYLLVKSGFFRFHIKYSQMTKIEATSNFLIGTRAMMATNG--IVIYYSSGIT-GELKLSPDDQDAFLKILQE
DSQ  TTAATCCCGGTAATCATTTTTCCTTTTAATTGGTTAATATTAATTATACTTGTTGGT---GTATTTGTTTTATCTACATTATTTATTTTATTGCCATGTTTTAATCTTTGTTATATTTTCTTCTATGACTATTTACTTGTGAAAAGCGGTTTCTTTCGTTTTCATATAAAGTATTCTCAAATGACTAAAATAGAAGCGACTTCTAATTTTTTGATCGGAACAAGAGCAATGATGGCGACAAATGGA------ATTGTTATATATTATTCGAGTGGAATTACA---GGAGAATTAAAATTATCTCCTGACGACCAGGATGCCTTTTTAAAAATTTTGCAGGAA
TRN  10010101110011010
NAM  Q8EQJ6_OCEIH/24-123
ASQ  IAPLLNGQWFASLLMIIIG-LFLL------WFWFRTGYRIDNDKILIYYGPVKQTVKIKDIEVIFKTKFPLTSP--ALSFDR--MQIKS--GKY-DIVTISPEEKESFLQQLMD
DSQ  ATTGCTCCTCTATTAAATGGTCAATGGTTCGCTTCTTTGTTAATGATTATAATTGGA---CTTTTTCTACTG------------------TGGTTTTGGTTCCGTACAGGCTATCGAATTGACAATGATAAAATACTTATTTATTATGGTCCCGTTAAGCAAACTGTAAAAATCAAAGATATAGAAGTTATTTTTAAGACAAAATTTCCGTTGACTTCTCCA------GCTCTTTCATTTGATCGA------ATGCAAATTAAGAGT------GGAAAGTAT---GATATTGTTACGATCTCACCTGAAGAGAAAGAATCATTCTTACAGCAGTTAATGGAT
TRN  10010101100011000
NAM  Q9K9B1_BACHD/14-114
ASQ  IPPIVEQSVILLIVLLSIV-IFLL------SIWFRTYDRIDGDRLFAISGPFRWSIPIQDIRSIEKRKNLLSGP--SLSLDR--LTILY--GVGYDIIVISPEKEDVFLQLLLD
DSQ  ATTCCTCCGATCGTAGAACAAAGTGTCATTCTTTTGATTGTCCTCCTCTCGATCGTC---ATCTTCCTTTTA------------------TCGATTTGGTTTCGAACGTATGACCGAATCGATGGGGACAGACTATTCGCGATCAGTGGTCCATTTCGATGGAGCATCCCAATTCAAGACATTCGGAGCATTGAAAAGCGGAAAAACTTGCTTTCAGGGCCA------AGCTTGTCACTCGATCGG------TTGACGATTCTATAT------GGGGTAGGCTATGACATCATCGTCATCTCACCTGAAAAGGAAGATGTGTTTCTTCAATTGTTGCTGGAC
TRN  10010101100011000
NAM  Q8CV26_OCEIH/33-133
ASQ  IIAFSASNFIEGLVGFIIV-VLLI------WAWFSTGYQIVNDIVKVKAGPFKKTINIQEINKISKRKSVWTAA--ALATDR--LVIQY--GKYNLDILVSPRNESDFIKLLLS
DSQ  ATTATTGCTTTTAGCGCATCTAATTTTATTGAAGGATTAGTTGGATTTATTATAGTG---GTTTTACTTATT------------------TGGGCGTGGTTTAGTACGGGTTATCAAATTGTAAACGATATTGTTAAAGTAAAGGCTGGACCATTTAAAAAAACAATAAATATACAAGAAATTAACAAAATTAGTAAGAGGAAAAGTGTGTGGACAGCAGCT------GCTTTAGCTACTGATAGA------TTGGTAATACAGTAC------GGAAAATATAATTTGGATATTCTTGTGTCTCCTAGGAATGAGAGTGATTTCATTAAACTCCTTCTGAGC
TRN  10010101100011010
NAM  Q9KEX6_BACHD/37-136
ASQ  LPSFFDTYPVRLTFFYTIA-GLLL------WIWFRTGYTVTEDWLVIEYGPFKKKVEIETIESIRETKNPFIDP--ALSMNK--LQLYY--GNS-RHIAISPQEKEHFKKQLVK
DSQ  TTACCAAGCTTTTTCGATACCTATCCAGTGAGATTAACCTTTTTCTATACAATAGCA---GGATTGTTGTTG------------------TGGATTTGGTTTCGAACAGGCTATACCGTAACAGAGGATTGGCTCGTCATCGAATACGGCCCTTTCAAAAAGAAGGTTGAGATCGAAACGATTGAAAGTATTCGTGAAACAAAAAATCCGTTTATCGATCCA------GCTCTATCGATGAACAAA------CTTCAGTTATATTAT------GGTAACAGT---AGACACATTGCTATTTCCCCTCAAGAAAAGGAACATTTTAAGAAACAGTTAGTAAAA
TRN  10010101110011010
NAM  Q8ELH5_OCEIH/28-127
ASQ  QSIYVEVDIVAIFVMAALI-LLLG------SIWFNTRYRIDNNTLRISYGPMKWSININEIKSIRKTTNLFVGP--CLSVHR--LEIHY--GNY-KVIQISPKRMQLFIKEIQK
DSQ  CAATCCATCTATGTTGAGGTCGATATAGTAGCTATTTTCGTTATGGCTGCCTTGATT---TTATTGCTAGGG------------------TCAATCTGGTTCAACACACGATACAGAATTGATAATAATACACTTCGAATATCCTACGGTCCGATGAAGTGGTCCATTAATATCAATGAGATTAAATCGATTCGGAAAACGACGAATTTGTTTGTAGGACCT------TGTCTCTCTGTTCACCGT------CTGGAGATTCATTAC------GGTAACTAT---AAAGTAATTCAAATTTCCCCAAAACGGATGCAATTGTTTATCAAAGAAATTCAAAAG
TRN  10010101100011000
NAM  Q99IS9_9ZZZZ/33-132
ASQ  STGTPTAWVVAAFI-TLVGVGLPL------WLLLSTRYVLGQGQLRVLSGPFKWCIPVAKITTIAPTSSPLSSP--ALSLDR--LRVDY--GVG-NSVMISPRNKEQFVKDIEA
DSQ  TCAACGGGGACGCCGACGGCTTGGGTGGTTGCCGCATTCATC---ACCCTCGTTGGCGTCGGGTTGCCGCTA------------------TGGCTGTTACTTTCCACTCGGTACGTACTCGGTCAGGGCCAGTTGCGGGTTCTGAGCGGCCCGTTCAAGTGGTGCATCCCTGTAGCGAAAATCACAACTATCGCGCCTACATCAAGTCCGCTTTCCAGTCCG------GCGCTTTCGCTGGATCGG------CTACGCGTAGACTAT------GGCGTGGGC---AATTCGGTCATGATCTCTCCGCGTAACAAGGAGCAGTTCGTCAAAGACATTGAGGCT
TRN  11011101101011000
NAM  YYAB_BACSU/31-134
ASQ  VLGNMRVSGWIIFILLTLLNGLII------WSFIDLKYVLKEHHLIIKAGLIKHQIPYENIDKVVQKKKLWSGF--RLIRSRHAITIYYQGG--WGHAVISPQKSEEFIHKLKE
DSQ  GTGCTGGGAAATATGAGAGTTTCCGGCTGGATCATTTTTATTCTGCTGACTCTTTTAAATGGACTCATCATT------------------TGGAGCTTTATTGACCTAAAATATGTATTGAAGGAACACCATCTGATCATTAAAGCCGGATTGATCAAACATCAAATTCCTTATGAAAACATCGATAAAGTCGTTCAAAAAAAGAAACTATGGTCCGGTTTT------CGTCTGATCCGCTCTCGCCATGCCATCACAATATATTATCAGGGGGGA------TGGGGACATGCAGTAATTTCACCGCAAAAATCTGAAGAATTTATCCACAAGCTCAAAGAA
TRN  10010101100011000
//