EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06703 - SPC25)
FAM  PF06703
PID  SPC25
DES  Microsomal signal peptidase 25 kDa subunit (SPC25)
IPR  IPR009582
ANO  5
ALN  185
AID  0.28085
APH  (((SPC25_DROME/12-191:0.50076,SPC25_CANFA/43-224:0.44486):0.21298,SPC25_CAEEL/3-180:0.69103):0.26624,YMF5_YEAST/1-177:1.81778,SPC25_ARATH/10-188:0.93244);
ATP  (((SPC25_DROME/12-191,SPC25_CANFA/43-224),SPC25_CAEEL/3-180),YMF5_YEAST/1-177,SPC25_ARATH/10-188);
ATL  4.86607
DNO  5
DLN  555
DID  0.409936
DPH  (SPC25_DROME/12-191:0.35017,(SPC25_CANFA/43-224:0.28924,(SPC25_ARATH/10-188:0.75622,YMF5_YEAST/1-177:1.01904):0.11895):0.17911,SPC25_CAEEL/3-180:0.49411);
DTP  (SPC25_DROME/12-191,(SPC25_CANFA/43-224,(SPC25_ARATH/10-188,YMF5_YEAST/1-177)),SPC25_CAEEL/3-180);
DTL  3.20684
RID  0.28085
RPH  (((SPC25_DROME/12-191:0.50076,SPC25_CANFA/43-224:0.44486):0.21298,SPC25_CAEEL/3-180:0.69103):0.26624,YMF5_YEAST/1-177:1.81778,SPC25_ARATH/10-188:0.93244);
RTP  (((SPC25_DROME/12-191,SPC25_CANFA/43-224),SPC25_CAEEL/3-180),YMF5_YEAST/1-177,SPC25_ARATH/10-188);
RTL  4.86607
LNK  SPC25_ARATH/10-188:P58684:AY065212
LNK  SPC25_CAEEL/3-180:Q9XWW1:AL032626
LNK  SPC25_CANFA/43-224:Q28250:U12687
LNK  SPC25_DROME/12-191:Q9VYY2:AE003486
LNK  YMF5_YEAST/1-177:Q04969:Z46729
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SPC25_CAEEL/3-180
ASQ  DEPVKVVNKWDGPTVKNALDEVVKKILN-DKVGWTESHNLMNLRLLISFIGVAFSAFACGYDYYEPFPKSKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDG---KQSRKWAWSSEIKAHDDKYTLSAEF--KKE-GRSGQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRSEQ
DSQ  GACGAGCCGGTGAAAGTTGTGAACAAATGGGACGGTCCAACAGTGAAGAATGCCCTTGATGAAGTCGTCAAAAAGATTCTGAAC---GACAAAGTCGGATGGACGGAATCGCATAATCTAATGAATCTGCGTCTTCTCATCTCATTCATCGGCGTCGCGTTCTCCGCGTTCGCCTGCGGCTACGACTACTACGAGCCGTTCCCAAAGTCGAAAATCGTGCTCGCCGTGTGCTCGGTTTCCTACTTCATATGCATGGGAATTCTTCAAATGTATCAGTGGTACGTCGAGAAGGACTGCATCTACGAGGCCACCGAAGTCGACGGA---------AAACAATCGAGAAAATGGGCGTGGAGCTCGGAGATCAAGGCTCACGACGATAAGTACACGCTGTCGGCCGAGTTT------AAGAAGGAA---GGACGCTCTGGACAGGGAAAAATCACGAAATCTATCGGAGCTTATATCGATAACGATGGAGAGATCATCGTGCCACTTGTGAAGAAGGAGGTCGACGACTTGTACAACCGCTTGATTCGTAGCGAACAA
TRN  10010101100011001
NAM  SPC25_DROME/12-191
ASQ  EELVKV-NKWDGSAVKHALDDAVKTCLLGDRPQLKEQFGLVNTRLALCALAVSVAIMAHAWDFTHPFPESRPVLLFSVLAYFALLGILTLHSSFREKGTFAVALQKDK---ERERLWEASSDMRKYDDKYLLTLSVRDTKN-GKRREQSSNKSCAAFIDQNGIVLDNLVANEVNRLFNALAADKK
DSQ  GAGGAGCTGGTGAAGGTC---AACAAGTGGGATGGATCCGCAGTGAAGCACGCCCTCGATGATGCAGTGAAAACCTGCCTCCTTGGCGATCGTCCCCAGCTGAAGGAGCAATTCGGCCTGGTCAACACCCGTTTGGCCCTCTGCGCCCTCGCCGTTTCCGTGGCTATAATGGCCCATGCTTGGGACTTCACCCACCCCTTCCCGGAATCCCGTCCAGTGCTCCTCTTCAGTGTTTTGGCCTACTTTGCACTCCTCGGCATTCTGACCCTGCACTCCAGTTTCCGCGAGAAGGGCACCTTTGCGGTGGCCCTGCAGAAGGACAAG---------GAGCGGGAGCGCCTGTGGGAGGCCAGCTCCGATATGCGCAAGTACGACGACAAGTACCTGCTGACCCTCAGTGTTCGCGACACGAAAAAT---GGCAAGCGGCGCGAGCAGAGCAGCAACAAGTCGTGCGCCGCCTTCATCGATCAGAATGGCATCGTCCTGGACAACCTGGTGGCCAACGAGGTCAACCGTCTGTTCAACGCCTTAGCTGCCGACAAGAAG
TRN  10010101100011010
NAM  SPC25_CANFA/43-224
ASQ  DKPVKI-DKWDGSAVKNSLDDSAKKVLL-EKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT-KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLATERK
DSQ  GATAAGCCTGTAAAAATT---GACAAATGGGATGGATCAGCTGTGAAGAATTCTTTGGATGATTCTGCCAAAAAGGTACTTCTG---GAAAAGTACAAGTATGTGGAGAATTTTGGTCTGATTGACGGTCGCCTCACCATCTGTACCATCTCCTGTTTCTTTGCCATAGTGGCATTGATTTGGGATTATATGCATCCCTTTCCAGAATCTAAGCCTGTTTTGGCTTTGTGTGTCATATCCTATTTTGTGATGATGGGGATCCTGACCATTTATACCTCATATAAGGAGAAGAGCATCTTTCTTGTGGCCCACAGGAAAGATCCTACAGGAATGGATCCTGATGATATTTGGCAGCTGTCCTCTAGTCTCAAAAGGTTTGATGACAAATACACTCTGAAGTTGACCTTCATCAGTGGAAGAACA---AAGCAGCAGCGAGAGGCCGAGTTCACCAAGTCCATTGCTAAGTTTTTTGACCACAGCGGGACACTGGTCATGGATGCATACGAGCCTGAAATATCCAGGCTCCATGACAGCCTTGCCACAGAAAGAAAA
TRN  10010101100011001
NAM  SPC25_ARATH/10-188
ASQ  NKNVKKANLLDHHSIKHILDESVSDIVT-SR-GYKEDVRLSNLKLILGTIIIVVALVAQFYN--KKFPENRDFLIGCIALYVVLNAVLQLILYTKEKNAILFTYPPEG--SFTSTGLVVSSKLPRFSDQYTLTIDSADPKSISAGKSVQLTKSVTQWFTKDGVLVEGLFWKDVEALIKNYAEEEP
DSQ  AACAAGAATGTTAAGAAGGCCAATCTATTGGACCACCACTCGATCAAGCACATCCTTGACGAATCCGTCTCCGATATCGTTACG---AGCCGT---GGCTATAAGGAGGATGTGAGATTGAGCAACCTCAAACTGATTTTGGGAACGATTATCATCGTTGTTGCTCTTGTTGCTCAATTCTACAAC------AAGAAATTCCCTGAGAACAGGGATTTTTTGATTGGATGCATCGCATTGTATGTAGTGTTGAATGCGGTGTTGCAGCTGATTCTGTACACTAAGGAGAAGAATGCGATTTTGTTCACCTATCCTCCTGAGGGA------TCATTCACCAGCACTGGTTTGGTGGTATCTTCAAAGTTGCCCAGATTCTCTGATCAGTACACTCTCACCATCGACAGTGCTGATCCAAAATCAATCTCAGCTGGGAAGTCAGTTCAGCTCACCAAAAGTGTCACCCAATGGTTCACGAAAGATGGAGTTCTTGTTGAGGGTTTATTCTGGAAAGACGTAGAAGCACTAATCAAGAACTATGCAGAAGAAGAACCA
TRN  10010101100011000
NAM  YMF5_YEAST/1-177
ASQ  MSSAKPINVYSIPELNQALDEALPSVFA--RLNYERSYALLDAKLYIGYSIAVVAGLSFFLDKKFERDQIVTYQKLLVGAYFVLSLLFWYFSRFIEKGTVYVGKRRGT-----KEEIYVKTKFEKNEPLYLVELVQKKKGE-NSKKELKAKLEVNKVFNESGYLQNDAYFKWFSEQHNVLDTKKN
DSQ  ATGAGTTCTGCTAAACCTATTAATGTATATTCAATCCCGGAGTTGAACCAAGCTTTAGATGAAGCCCTACCTTCTGTTTTCGCG------AGATTAAATTACGAGAGATCATACGCTTTACTCGATGCTAAATTGTACATAGGTTATTCCATAGCTGTTGTAGCTGGTTTGAGTTTCTTCTTGGATAAAAAATTTGAGAGAGATCAGATTGTTACGTATCAAAAGCTTTTGGTAGGCGCATATTTTGTGCTCTCGCTACTTTTCTGGTATTTCTCTCGTTTTATTGAAAAGGGGACTGTTTATGTGGGAAAGAGAAGAGGTACA---------------AAGGAGGAAATATATGTAAAGACAAAGTTCGAAAAGAACGAACCATTATATCTGGTTGAGCTTGTTCAGAAAAAAAAGGGAGAA---AACTCCAAGAAGGAGTTGAAGGCAAAATTAGAAGTGAATAAGGTTTTTAATGAAAGTGGATATTTACAGAACGATGCGTATTTTAAGTGGTTCTCTGAACAGCACAATGTCCTCGACACCAAAAAAAAT
TRN  10010101100011000
//