EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06686 - SpoIIIAC)
FAM  PF06686
PID  SpoIIIAC
DES  Stage III sporulation protein AC (SpoIIIAC)
IPR  IPR009570
ANO  6
ALN  63
AID  0.481684
APH  (((Q9K955_BACHD/4-66:0.17967,SP3AC_BACSU/4-66:0.19303):0.22436,Q8EQ31_OCEIH/4-66:0.20960):0.58633,(Q8RAD8_THETN/2-64:0.58232,Q97HC1_CLOAB/3-65:0.28735):0.26278,Q8XJC9_CLOPE/3-65:0.26773);
ATP  (((Q9K955_BACHD/4-66,SP3AC_BACSU/4-66),Q8EQ31_OCEIH/4-66),(Q8RAD8_THETN/2-64,Q97HC1_CLOAB/3-65),Q8XJC9_CLOPE/3-65);
ATL  2.79317
DNO  6
DLN  189
DID  0.556261
DPH  ((((SP3AC_BACSU/4-66:0.23704,Q9K955_BACHD/4-66:0.21018):0.06388,Q8EQ31_OCEIH/4-66:0.24807):0.35386,Q8XJC9_CLOPE/3-65:0.29877):0.12395,Q8RAD8_THETN/2-64:0.29964,Q97HC1_CLOAB/3-65:0.27164);
DTP  ((((SP3AC_BACSU/4-66,Q9K955_BACHD/4-66),Q8EQ31_OCEIH/4-66),Q8XJC9_CLOPE/3-65),Q8RAD8_THETN/2-64,Q97HC1_CLOAB/3-65);
DTL  2.11104
RID  0.481684
RPH  (((Q9K955_BACHD/4-66:0.17967,SP3AC_BACSU/4-66:0.19303):0.22436,Q8EQ31_OCEIH/4-66:0.20960):0.58633,(Q8RAD8_THETN/2-64:0.58232,Q97HC1_CLOAB/3-65:0.28735):0.26278,Q8XJC9_CLOPE/3-65:0.26773);
RTP  (((Q9K955_BACHD/4-66,SP3AC_BACSU/4-66),Q8EQ31_OCEIH/4-66),(Q8RAD8_THETN/2-64,Q97HC1_CLOAB/3-65),Q8XJC9_CLOPE/3-65);
RTL  2.79317
LNK  Q8EQ31_OCEIH/4-66:Q8EQ31:BA000028
LNK  Q8RAD8_THETN/2-64:Q8RAD8:AE013090
LNK  Q8XJC9_CLOPE/3-65:Q8XJC9:BA000016
LNK  Q97HC1_CLOAB/3-65:Q97HC1:AE007711
LNK  Q9K955_BACHD/4-66:Q9K955:BA000004
LNK  SP3AC_BACSU/4-66:P49780:U35252
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8XJC9_CLOPE/3-65
ASQ  DLSLIFQIAGVGIVLVILDKVLDQSGKKEYATLANIVGVVIILTMMIQLISRLFSSVKSMFLF
DSQ  GATTTATCTTTGATTTTTCAGATTGCAGGAGTTGGTATAGTGCTTGTTATACTAGATAAAGTTCTTGATCAAAGTGGTAAAAAGGAGTATGCAACTTTAGCTAATATAGTTGGAGTAGTCATAATACTTACCATGATGATTCAACTTATAAGTAGATTATTTTCTTCTGTTAAATCTATGTTTTTATTT
TRN  10010101110011010
NAM  Q97HC1_CLOAB/3-65
ASQ  DISLLFKIAGVGILTIIIDKILKSSGKDDFAVVTNLAGIVILLLMVISLISKLFEAVKTMFQL
DSQ  GATATATCGCTTTTATTTAAAATTGCGGGAGTTGGAATTCTTACTATAATTATAGATAAAATACTTAAATCCAGTGGAAAAGATGATTTTGCAGTAGTAACAAATTTGGCAGGCATAGTGATCCTCCTCTTGATGGTAATAAGCCTAATAAGTAAATTGTTTGAGGCTGTAAAGACTATGTTTCAACTT
TRN  10010101110011010
NAM  Q8RAD8_THETN/2-64
ASQ  NIDIIFKIAAIGILVTVLNQILIRSGREEQAMMVTLAGIVVVLMMVIHLINNLFNTVKTIFHL
DSQ  AACATAGACATAATCTTTAAGATTGCGGCAATAGGAATTTTAGTGACTGTTTTAAATCAAATTCTCATACGATCCGGGAGAGAAGAACAGGCTATGATGGTGACTCTAGCAGGAATAGTAGTAGTCCTCATGATGGTAATCCACCTTATAAACAATCTTTTTAACACTGTAAAGACCATATTTCATCTG
TRN  10010101100011010
NAM  Q9K955_BACHD/4-66
ASQ  DVNTIFQIAGIGIVVAMIHTVLKQMGKEDWAHWVTLIGFVVVLYMVATIVDDLFQKIRGVFLF
DSQ  GACGTAAATACCATTTTCCAAATTGCTGGTATTGGTATTGTAGTTGCCATGATTCATACAGTGTTAAAGCAAATGGGAAAAGAGGATTGGGCCCATTGGGTGACCTTGATTGGGTTTGTCGTCGTCCTTTATATGGTTGCGACGATTGTAGATGATCTCTTTCAAAAAATTCGAGGCGTCTTTCTATTT
TRN  11011101111011010
NAM  SP3AC_BACSU/4-66
ASQ  DVNVIFQIAGVGIVVAFLHTILDQMGKKEYAQWVTLLGFIYILFMVATIVDDLFKKIKAVFLF
DSQ  GACGTGAATGTCATATTTCAAATCGCCGGAGTGGGAATCGTGGTCGCTTTTTTACACACGATATTGGATCAGATGGGCAAGAAAGAATATGCTCAGTGGGTGACGCTGTTAGGTTTTATCTATATTTTATTTATGGTCGCCACGATTGTAGATGACCTATTTAAAAAGATAAAAGCTGTGTTTTTATTC
TRN  10010101100011010
NAM  Q8EQ31_OCEIH/4-66
ASQ  DATILFQIAGIGIIVALIHTILKQMGKEEIAQFATLIGFIIVLVIVVNGLSDLFQQIKSVFLF
DSQ  GACGCAACGATACTATTCCAAATTGCAGGAATTGGAATAATAGTAGCACTCATTCATACAATCTTGAAACAAATGGGGAAAGAAGAAATTGCTCAGTTTGCGACACTAATTGGGTTTATTATTGTTCTTGTTATTGTCGTAAATGGATTATCAGATTTATTCCAACAAATTAAATCGGTATTTTTATTC
TRN  10010101110011000
//